Align 3-isopropylmalate dehydrogenase; 3-IPM-DH; IMDH; EC 1.1.1.85; Beta-IPM dehydrogenase (uncharacterized)
to candidate 200708 SO1538 isocitrate dehydrogenase, NAD-dependent (NCBI ptt file)
Query= curated2:O29627 (326 letters) >FitnessBrowser__MR1:200708 Length = 335 Score = 308 bits (789), Expect = 1e-88 Identities = 163/332 (49%), Positives = 217/332 (65%), Gaps = 8/332 (2%) Query: 2 KKIVVIPGDGIGKEVMEAAMLILEKLDLPFEYSYYDAGDEALEKYGKALPDETLEACRKS 61 + I VIPGDGIG ++++A+ IL+K FEY + DAG ALEK G+ LP TLE K+ Sbjct: 4 RTITVIPGDGIGPSIIDSALKILDKAGCDFEYEFADAGLAALEKQGELLPQRTLELIEKN 63 Query: 62 DAVLFGA----AGETAADVIVRLRRELGTFANVRPAKAIEGIECLYPGLDIVVVRENTEC 117 L G GE + V LR++ G +ANVRP + +G + Y +DI+ VRENTE Sbjct: 64 RITLKGPLTTPVGEGFTSINVTLRKKFGLYANVRPVLSFKGTQARYENIDIITVRENTEG 123 Query: 118 LYMGFEFGF---GDVTEAIRVITREASERIARYAFELAKREGRKKVTALHKANVMKKTCG 174 +Y G G EA ++TR+ +E+IA +A+ELA++E RKKVT +HKAN+MK T G Sbjct: 124 MYSGHGQKVSEDGSTAEATSIVTRQGAEQIATFAYELARKESRKKVTIVHKANIMKSTSG 183 Query: 175 LFRDVCREVAKDYPEIQYNDYYIDAACMYLVMDPFRFDVIVTTNMFGDIVSDLAAGLVGG 234 LF V REV+ YP+I+ + +DA CM LVM+P FDVIVTTN+FGDI+SDL AGLVGG Sbjct: 184 LFLKVAREVSLRYPDIKTEEMIVDATCMKLVMNPENFDVIVTTNLFGDILSDLCAGLVGG 243 Query: 235 LGLAPSANVGERTAIFEPVHGAAFDIAGKGIANPTAMILTACMMLRHFGYVEEAKKVEEA 294 LG+AP AN+G AIFE VHG+A DIAGK +ANPT++IL + ML + G ++A + +A Sbjct: 244 LGMAPGANIGRDAAIFEAVHGSAPDIAGKNLANPTSVILASIQMLEYLGMADKAAPIRKA 303 Query: 295 VEKTIKEGKKTP-DLGGNLKTMEFANEVASLL 325 V I+EG +T DLGG T +F V L Sbjct: 304 VSAVIEEGDRTTRDLGGTHGTTDFTQAVLDRL 335 Lambda K H 0.321 0.139 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 335 Length adjustment: 28 Effective length of query: 298 Effective length of database: 307 Effective search space: 91486 Effective search space used: 91486 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory