Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; Tetrahydrodipicolinate N-succinyltransferase; THDP succinyltransferase; THP succinyltransferase; Tetrahydropicolinate succinylase; EC 2.3.1.117 (characterized)
to candidate 200790 SO1625 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase (NCBI ptt file)
Query= SwissProt::P56220 (274 letters) >FitnessBrowser__MR1:200790 Length = 274 Score = 446 bits (1147), Expect = e-130 Identities = 220/274 (80%), Positives = 241/274 (87%) Query: 1 MQQLQNVIESAFERRADITPANVDTVTREAVNQVIGLLDSGALRVAEKIDGQWVTHQWLK 60 M+ L+ IE+AFE R DITP+ VD R V VI +LD G LRVAEKIDG W HQWLK Sbjct: 1 MEALRQRIEAAFEARTDITPSTVDERVRSDVQHVINMLDKGELRVAEKIDGLWHVHQWLK 60 Query: 61 KAVLLSFRINDNKVMDGAETRYYDKVPMKFADYDEARFQKEGFRVVPPATVRQGAFIARN 120 KAVLLSFRI DN V+DGAET+Y+DKVP+KFA+YDEARF+ E RVVP ATVR+G+FI +N Sbjct: 61 KAVLLSFRIFDNAVIDGAETKYFDKVPLKFAEYDEARFKAEAIRVVPSATVRKGSFIGKN 120 Query: 121 TVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIED 180 TVLMPSYVN+GAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQA PTIIED Sbjct: 121 TVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAGPTIIED 180 Query: 181 NCFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIYDRETGEIHYGRVPAGSVVVSGNLPS 240 NCFIGARSE+VEGV+VEEGSVISMGVY+GQSTRIYDRETGE+HYGRVPAGSVVVSGNLPS Sbjct: 181 NCFIGARSEIVEGVVVEEGSVISMGVYIGQSTRIYDRETGEVHYGRVPAGSVVVSGNLPS 240 Query: 241 KDGSYSLYCAVIVKKVDAKTRGKVGINELLRTID 274 G YSLY A+IVKKVDAKTR KVGINELLR +D Sbjct: 241 ACGKYSLYAAIIVKKVDAKTRSKVGINELLRIVD 274 Lambda K H 0.318 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 274 Length adjustment: 25 Effective length of query: 249 Effective length of database: 249 Effective search space: 62001 Effective search space used: 62001 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate 200790 SO1625 (2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase (NCBI ptt file))
to HMM TIGR00965 (dapD: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00965.hmm # target sequence database: /tmp/gapView.24241.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00965 [M=271] Accession: TIGR00965 Description: dapD: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-151 489.7 2.3 1.4e-151 489.5 2.3 1.0 1 lcl|FitnessBrowser__MR1:200790 SO1625 2,3,4,5-tetrahydropyridin Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:200790 SO1625 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 489.5 2.3 1.4e-151 1.4e-151 2 270 .. 4 272 .. 3 273 .. 0.99 Alignments for each domain: == domain 1 score: 489.5 bits; conditional E-value: 1.4e-151 TIGR00965 2 lqkiietaferraeilpasklikvkeavnesiasldsgalrvaekldgqwkvnewvkkavllsfritdnqvlndavnky 80 l++ ie afe r +i+p++++ +v+ v+++i++ld+g lrvaek+dg w+v++w+kkavllsfri dn v+++a++ky lcl|FitnessBrowser__MR1:200790 4 LRQRIEAAFEARTDITPSTVDERVRSDVQHVINMLDKGELRVAEKIDGLWHVHQWLKKAVLLSFRIFDNAVIDGAETKY 82 6789*************************************************************************** PP TIGR00965 81 fdkvatkfadydedefkeaglrkvpgavvrrgafiaknvvlmpsyvnigayvdegtmvdtwatvgscaqigknvhlsgg 159 fdkv+ kfa+yde++fk +++r+vp+a vr+g+fi kn+vlmpsyvn+gayvdegtmvdtwatvgscaqigknvhlsgg lcl|FitnessBrowser__MR1:200790 83 FDKVPLKFAEYDEARFKAEAIRVVPSATVRKGSFIGKNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGG 161 ******************************************************************************* PP TIGR00965 160 vgiggvleplqakpviiedncfigarseivegviveegsvismgvfigqstkivdretgeiiygrvpagsvvvsgslps 238 vgiggvleplqa p+iiedncfigarseivegv+veegsvismgv+igqst+i+dretge++ygrvpagsvvvsg+lps lcl|FitnessBrowser__MR1:200790 162 VGIGGVLEPLQAGPTIIEDNCFIGARSEIVEGVVVEEGSVISMGVYIGQSTRIYDRETGEVHYGRVPAGSVVVSGNLPS 240 ******************************************************************************* PP TIGR00965 239 kdgkkslycavivkkvdaktrgkvsinellrt 270 gk+sly a+ivkkvdaktr+kv+inellr lcl|FitnessBrowser__MR1:200790 241 ACGKYSLYAAIIVKKVDAKTRSKVGINELLRI 272 ******************************95 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (271 nodes) Target sequences: 1 (274 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.77 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory