Align Alpha-aminoadipate--LysW ligase LysX; AAA--LysW ligase LysX; EC 6.3.2.43 (characterized)
to candidate 201352 SO2200 ribosomal protein S6 modification protein, putative (NCBI ptt file)
Query= SwissProt::Q7SI95 (275 letters) >FitnessBrowser__MR1:201352 Length = 330 Score = 85.5 bits (210), Expect = 1e-21 Identities = 65/212 (30%), Positives = 105/212 (49%), Gaps = 13/212 (6%) Query: 61 VEQVGYPVINDHTTLIRCENKIFTTYILARHNIPTPKTFIAFDKTNAIEYSKKLGYPVVI 120 +E++G +N + ++K+F+ +LA N+PTPKT + + + LG+PVVI Sbjct: 87 LERLGVYCLNPSKAIEIVKDKLFSQQLLAEKNLPTPKTMLVKFPVDIDLVERHLGFPVVI 146 Query: 121 KPVEGSWGRMV---AKADNLDVLYSYLEYQEFSTQKYKDIYYIQEFV-NKPNRDIRIFVI 176 K + GS G V KA D L +E +T K +I +QEF+ N RD+R+F I Sbjct: 147 KTLSGSQGSGVFLSHKAREFDDLMQLIE----ATNKNANI-ILQEFIANSHGRDLRVFTI 201 Query: 177 GDETPVGIY--RVNENNWRTNTALGAKAYPLKIDEELRELALKVKDIIGGFFLGIDIFED 234 G G Y R E++++ N + G A P I E+ LA + +I+ GID+ D Sbjct: 202 GGRV-AGCYERRGQEDSFKANVSAGGSARPFDITPEIEWLATQTANILDLDVAGIDLLFD 260 Query: 235 KDRGYLVDEVNGVPEYKNTVRVNNFNVSKFLL 266 Y + E N P ++ N +++ +L Sbjct: 261 NGH-YKICEANSSPGFEGLESCLNVDIAAQIL 291 Lambda K H 0.320 0.139 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 330 Length adjustment: 27 Effective length of query: 248 Effective length of database: 303 Effective search space: 75144 Effective search space used: 75144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory