Align alanine racemase (EC 5.1.1.1) (characterized)
to candidate 201343 SO2191 cystathionine beta-lyase (NCBI ptt file)
Query= BRENDA::P06721 (395 letters) >FitnessBrowser__MR1:201343 Length = 399 Score = 420 bits (1079), Expect = e-122 Identities = 210/394 (53%), Positives = 280/394 (71%), Gaps = 6/394 (1%) Query: 1 MADK-KLDTQLVNAGRSKKYTLGAVNSVIQRASSLVFDSVEAKKHATRNRANGELFYGRR 59 M DK +L TQ+V+ GR KK+T G +N + RAS++VFD++E +HA +N+ NGE+FYGRR Sbjct: 1 MTDKHQLATQIVSVGRDKKWTKGVINPPVFRASTIVFDTMEDMRHAAKNKTNGEMFYGRR 60 Query: 60 GTLTHFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQGDHVLMTNTAYEPSQDFCS 119 GT THF+ Q A+ ELEGGAG L+P GAAA++ ++L+F++ GDH+LM ++ YEP++DFCS Sbjct: 61 GTPTHFAFQAAVSELEGGAGTALYPSGAAAISAALLSFLQAGDHLLMVDSVYEPTRDFCS 120 Query: 120 KILSKLGVTTSWFDPLIGADIVKHLQPNTKIVFLESPGSITMEVHDVPAIVAAVRSVVPD 179 IL+ + T+++DPLIG I ++PNTK++FLESPGSITMEV DVP + Sbjct: 121 HILAGFNIETTYYDPLIGEGIRALIRPNTKVLFLESPGSITMEVQDVPTLCRIAHE--HG 178 Query: 180 AIIMIDNTWAAGVLFKALDFGIDVSIQAATKYLVGHSDAMIGTAVCNARCWEQLRENAYL 239 + ++DNTWA+ + K + G+DVSIQAATKY+VGHSD MIGTA N + W QLRE +YL Sbjct: 179 LVTILDNTWASPINSKPFEMGVDVSIQAATKYIVGHSDVMIGTATANEQYWPQLRERSYL 238 Query: 240 MGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSKGHEF 299 +GQ D Y+ +RGLRTLGVR+ QH +++LKVA WL P+V + HPA GHEF Sbjct: 239 LGQTTSPDDVYLATRGLRTLGVRMAQHEKNALKVANWLQTRPEVDHLRHPAFETCPGHEF 298 Query: 300 WKRDFTGSSGLFSFVLKKKLNNEELANYLDNFSLFSMAYSWGGYESLILANQPEHIAAIR 359 +KRDF+ S+GLFSFVLK+ + E + ++N F M +SWGGYESLIL I IR Sbjct: 299 FKRDFSASNGLFSFVLKQG-DQEAVTALVENMQHFKMGFSWGGYESLILG--IFGIERIR 355 Query: 360 PQGEIDFSGTLIRLHIGLEDVDDLIADLDAGFAR 393 + D S LIR+HIGLED +DLIADL AGF R Sbjct: 356 SATKWDASKPLIRVHIGLEDPEDLIADLSAGFER 389 Lambda K H 0.321 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 437 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 399 Length adjustment: 31 Effective length of query: 364 Effective length of database: 368 Effective search space: 133952 Effective search space used: 133952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory