Align D-3-phosphoglycerate dehydrogenase; PGDH; EC 1.1.1.95 (uncharacterized)
to candidate 202727 SO3631 glycerate dehydrogenase (NCBI ptt file)
Query= curated2:Q58424 (524 letters) >FitnessBrowser__MR1:202727 Length = 318 Score = 158 bits (399), Expect = 3e-43 Identities = 99/302 (32%), Positives = 159/302 (52%), Gaps = 13/302 (4%) Query: 18 LEEVGEVEVATGLTKEELLEKIKDADVLVVRSGTKVTRDVIEKAEKLKVIGRAGVGVDNI 77 + ++G+ E++ + +DA++ V + T + + + KLK +G G + + Sbjct: 21 ISDLGKFSCFARTPDAEIIPRAQDAEI-VFTNKTPLDAKTLAQLPKLKYVGVLATGTNVV 79 Query: 78 DVEAATEKGIIVVNAPDASSISVAELTMGLMLAAARNIPQATASLKRGEWDR------KR 131 D+ AA + GI+V N P +VA++ +L + + ++ G+W Sbjct: 80 DIAAAKDLGIVVTNVPAYGHDAVAQMVFAHILHHTQAVAAHHQAVAAGQWTSCSDFCFTL 139 Query: 132 FKGIELYGKTLGVIGLGRIGQQVVKRAKAFGMNIIGYDPYIPKEVAESMGVELVDDINEL 191 L GKTLG+IG G IGQQV K A AFGM ++ P + + + D + Sbjct: 140 MPLQSLKGKTLGLIGYGDIGQQVAKLALAFGMKVLVNTRTEPAHLPQGVSWTSRDKV--- 196 Query: 192 CKRADFITLHVPLTPKTRHIIGREQIALMKKNAIIVNCARGGLIDEKALYEALKEGKIRA 251 K +D ++LH PLTP+T +I + + LMK A+++N ARGGLIDE AL AL +G++ Sbjct: 197 LKESDILSLHCPLTPETNELINAQTLELMKPQALLINTARGGLIDEAALAVALTQGRV-F 255 Query: 252 AALDVFEEEPPK-DNPLLTLDNVIGTPHQGASTEEAQKAAGTIVAEQIKKVLRGELAENV 310 A +DV EPP DNPLL+ N+ +PH +T+EA++ I E +K L+G + N Sbjct: 256 AGVDVLSTEPPSMDNPLLSAPNISTSPHNAWATKEARQNLLNIATENLKSFLQGNI-RNC 314 Query: 311 VN 312 VN Sbjct: 315 VN 316 Lambda K H 0.316 0.137 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 524 Length of database: 318 Length adjustment: 31 Effective length of query: 493 Effective length of database: 287 Effective search space: 141491 Effective search space used: 141491 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory