Alignments for a candidate for trpD_1 in Shewanella oneidensis MR-1

GapMind for Amino acid biosynthesis

Alignments for a candidate for trpD_1 in Shewanella oneidensis MR-1

Align Anthranilate synthase component 2; AS; ASII; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component; EC 4.1.3.27 (characterized)
to candidate 202142 SO3020 glutamine amido-transferase (NCBI ptt file)

Query= SwissProt::P00900
         (193 letters)



>FitnessBrowser__MR1:202142
          Length = 202

 Score =  207 bits (527), Expect = 1e-58
 Identities = 104/187 (55%), Positives = 136/187 (72%), Gaps = 1/187 (0%)

Query: 4   ILLLDNVDSFTYNLVDQLRASGHQVVIYRNQIGAEVIIERLQHMEQPV-LMLSPGPGTPS 62
           + LLDN DSFTYNLVDQ R+ G +VVIYRN + A+ I ++L     P  L+LSPGPG P 
Sbjct: 3   LYLLDNFDSFTYNLVDQFRSLGCEVVIYRNDVAADYIADKLLAETAPTALVLSPGPGAPH 62

Query: 63  EAGCMPELLQRLRGQLPIIGICLGHQAIVEAYGGQVGQAGEILHGKASAIAHDGEGMFAG 122
           EAG M EL+ ++ G++P++GICLGHQA+VE YGG+V +A  ++HGKAS   H+G G+FA 
Sbjct: 63  EAGSMMELIDKVAGKVPMLGICLGHQAMVEYYGGKVERAPFVVHGKASPTFHNGTGVFAN 122

Query: 123 MANPLPVARYHSLVGSNIPADLTVNARSGEMVMAVRDDRRRVCGFQFHPESILTTHGARL 182
           + +PLPVARYHSLV + +P  L V A + +M MA+   + R  GFQFHPESILTT G+ L
Sbjct: 123 LPSPLPVARYHSLVATKVPNCLDVIATTDDMPMAILHAKHRAVGFQFHPESILTTLGSTL 182

Query: 183 LEQTLAW 189
           L QTL +
Sbjct: 183 LTQTLVY 189


Lambda     K      H
   0.322    0.138    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 134
Number of extensions: 5
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 193
Length of database: 202
Length adjustment: 20
Effective length of query: 173
Effective length of database: 182
Effective search space:    31486
Effective search space used:    31486
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)

Align candidate 202142 SO3020 (glutamine amido-transferase (NCBI ptt file))
to HMM TIGR00566 (glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase)

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00566.hmm
# target sequence database:        /tmp/gapView.7400.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00566  [M=192]
Accession:   TIGR00566
Description: trpG_papA: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                       -----------
    3.2e-58  182.7   0.0    3.8e-58  182.5   0.0    1.0  1  lcl|FitnessBrowser__MR1:202142  SO3020 glutamine amido-transfera


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__MR1:202142  SO3020 glutamine amido-transferase (NCBI ptt file)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  182.5   0.0   3.8e-58   3.8e-58       2     188 ..       3     185 ..       2     189 .. 0.94

  Alignments for each domain:
  == domain 1  score: 182.5 bits;  conditional E-value: 3.8e-58
                       TIGR00566   2 vllidnydsftynlvqlleelgaevvvkrndsltlqeieallplls...ivisPGPctPdeaaissleliehlaGklPi 77 
                                     + l+dn+dsftynlv+++  lg evv+ rnd   +   ++ll++++   +v+sPGP+ P+ea+   +eli+++aGk+P+
  lcl|FitnessBrowser__MR1:202142   3 LYLLDNFDSFTYNLVDQFRSLGCEVVIYRNDVAADYIADKLLAETAptaLVLSPGPGAPHEAGSM-MELIDKVAGKVPM 80 
                                     5699****************************999999**999987788*************975.9************ PP

                       TIGR00566  78 lGvClGhqalaqafGadvvraekvkhGkvseiehngaavfaglfnPdalkatryhslvveaetldtllevtaleeeeie 156
                                     lG+ClGhqa+    G++v ra  v hGk s   hng++vfa l +P  l+++ryhslv  a +++++l+v a+++    
  lcl|FitnessBrowser__MR1:202142  81 LGICLGHQAMVEYYGGKVERAPFVVHGKASPTFHNGTGVFANLPSP--LPVARYHSLV--ATKVPNCLDVIATTDDM-- 153
                                     **********************************************..*********8..689*******9998876.. PP

                       TIGR00566 157 imairhrdlpleGvqfhPesilselGkellan 188
                                      mai h +    G qfhPesil+ lG++ll+ 
  lcl|FitnessBrowser__MR1:202142 154 PMAILHAKHRAVGFQFHPESILTTLGSTLLTQ 185
                                     799999999999****************9976 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (192 nodes)
Target sequences:                          1  (202 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 5.44
//
[ok]

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.

Downloads

Candidates (tab-delimited)
Steps (tab-delimited)
Rules (tab-delimited)
Protein sequences (fasta format)
Organisms (tab-delimited)
SQLite3 databases

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
HMMer finds a hit (regardless of coverage or other bits).

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

our ignorance of proteins' functions,
omissions in the gene models,
frame-shift errors in the genome sequence, or
the organism lacks the pathway.

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

the paper from 2019 on GapMind for amino acid biosynthesis
the paper from 2022 on GapMind for carbon sources
the source code
instructions for running GapMind on your computer
changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory

GapMind for Amino acid biosynthesis