Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate 202143 SO3021 anthranilate phosphoribosyltransferase (NCBI ptt file)
Query= SwissProt::P83827 (329 letters) >FitnessBrowser__MR1:202143 Length = 347 Score = 246 bits (629), Expect = 5e-70 Identities = 139/322 (43%), Positives = 193/322 (59%), Gaps = 9/322 (2%) Query: 10 GEVLEEEEAYEVMRALMAGEVSPVRAAGLLVALSLRGERPHEIAAMARAMREAARPLRV- 68 G+ L E+ + L+ GE++ AG+L+AL +RGE EI+ A AMR AA+P Sbjct: 16 GKALTREQTASLFSVLIQGEMNETVMAGMLMALKIRGETIEEISGAADAMRAAAKPFPYP 75 Query: 69 ---HRRPLLDIVGTGGDGKGLMNLSTLAALVAAAGGVAVAKHGNRAASSRAGSADLLEAL 125 + ++DIVGTGGDG +N+ST AA VAAA G VAKHGNR+ SS++GS+DLL Sbjct: 76 ESSRSQGVIDIVGTGGDGFNTINISTTAAFVAAAAGAKVAKHGNRSVSSKSGSSDLLAQF 135 Query: 126 GVDLEAPPERVGEAIEELGFGFLFARVFHPAMRHVAPVRAELGVRTVFNLLGPLTNPAGA 185 G+DL PE +E L FLFA +H ++H PVR L RT+FN+LGPL NPA Sbjct: 136 GIDLTMSPELASHCLEALNLCFLFAPHYHGGVKHAVPVRQTLKTRTLFNVLGPLINPARP 195 Query: 186 DAYVLGVFSPEWLAPMAEALERLGA-RGLVVHGEGADELVL-GENRVVEVGKG---AYAL 240 + +LGV+S E + P+A L+ LG R +VVHG G DE+ L G +V E+ G Y L Sbjct: 196 EFMLLGVYSAELVTPIARVLQALGTQRAMVVHGSGLDEVALHGSTQVAELKDGEIIEYQL 255 Query: 241 TPEEVGLKRAPLEALKGGGPEENAALARRLLKGEEKGPLADAVALAAGAGFYAAGKTPSL 300 TP + G+ +A + L+GG P NA + +++L+G AVA+ AG Y G + S+ Sbjct: 256 TPADFGVPQAHISELEGGEPAHNALITQQILQGHGCDAHTHAVAINAGCALYLCGLSESV 315 Query: 301 KEGVALAREVLASGEAYLLLER 322 K G ALA + +G+AY LL + Sbjct: 316 KMGTALALSTIKTGKAYELLHK 337 Lambda K H 0.317 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 347 Length adjustment: 28 Effective length of query: 301 Effective length of database: 319 Effective search space: 96019 Effective search space used: 96019 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate 202143 SO3021 (anthranilate phosphoribosyltransferase (NCBI ptt file))
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.27565.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-130 419.5 0.4 5.8e-130 419.3 0.4 1.0 1 lcl|FitnessBrowser__MR1:202143 SO3021 anthranilate phosphoribos Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:202143 SO3021 anthranilate phosphoribosyltransferase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 419.3 0.4 5.8e-130 5.8e-130 4 328 .. 13 339 .. 10 341 .. 0.98 Alignments for each domain: == domain 1 score: 419.3 bits; conditional E-value: 5.8e-130 TIGR01245 4 lldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkveke...eseelvDivGTGG 79 l+++k L++e+ ++l++ +++ge++++ +a +l+al+++get+eei+g+a a+r+ ak ++ s+ ++DivGTGG lcl|FitnessBrowser__MR1:202143 13 LFQGKALTREQTASLFSVLIQGEMNETVMAGMLMALKIRGETIEEISGAADAMRAAAKPFPYPessRSQGVIDIVGTGG 91 7899******************************************************997642236789********* PP TIGR01245 80 DglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsleevgigFlfAPkyhpalkev 158 Dg++tiNiST++a+vaaaaG+kvaKhGnrsvssksGs+D+L ++g+ l +spe + ++le ++++FlfAP+yh ++k++ lcl|FitnessBrowser__MR1:202143 92 DGFNTINISTTAAFVAAAAGAKVAKHGNRSVSSKSGSSDLLAQFGIDLTMSPELASHCLEALNLCFLFAPHYHGGVKHA 170 ******************************************************************************* PP TIGR01245 159 apvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlgvkralvvhgedglDEisltgetkvaelkdg 237 +pvR++L++rt+fN+LGPL+nPar+++ +lGvys++lv+ +a+vl++lg++ra+vvhg +glDE++l+g+t+vaelkdg lcl|FitnessBrowser__MR1:202143 171 VPVRQTLKTRTLFNVLGPLINPARPEFMLLGVYSAELVTPIARVLQALGTQRAMVVHG-SGLDEVALHGSTQVAELKDG 248 **********************************************************.******************** PP TIGR01245 238 eieeytlspedfglkraeleelkggsaeenaellkevlegkekkakrdivvlNaaaalyvagkakdlkegvelakeaik 316 ei ey+l+p+dfg+++a+++el+gg++++na +++++l+g++ +a++++v++Na+ aly+ g +++k g+ la+ +ik lcl|FitnessBrowser__MR1:202143 249 EIIEYQLTPADFGVPQAHISELEGGEPAHNALITQQILQGHGCDAHTHAVAINAGCALYLCGLSESVKMGTALALSTIK 327 ******************************************************************************* PP TIGR01245 317 sgkalekleelv 328 +gka+e+l++l+ lcl|FitnessBrowser__MR1:202143 328 TGKAYELLHKLA 339 ********9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (347 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.52 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory