GapMind for Amino acid biosynthesis

 

Alignments for a candidate for argA in Marinobacter adhaerens HP15

Align amino-acid N-acetyltransferase (EC 2.3.1.1) (characterized)
to candidate GFF3372 HP15_3314 N-acetyllutamate synthase

Query= BRENDA::P22567
         (432 letters)



>FitnessBrowser__Marino:GFF3372
          Length = 435

 Score =  476 bits (1226), Expect = e-139
 Identities = 234/431 (54%), Positives = 316/431 (73%), Gaps = 1/431 (0%)

Query: 3   DYVNWLRHASPYINSHRDRTFVVMLPGEGVEHPNFGNIVHDLVLLHSLGARLVLVHGSRP 62
           D+++  RH+SPYIN+HR RT V+ +PG+ +EH NF NI+HD+ LL SLG RLV+  G+RP
Sbjct: 5   DWLHGFRHSSPYINAHRGRTVVLTIPGDAIEHGNFINIIHDIALLSSLGVRLVVAFGARP 64

Query: 63  QIEARLAARGLAPRYHRDLRVTDAPTLECVIDAVGSLRIAIEARLSMDMAASPMQGARLR 122
           QI+ RL A G+   + + LR+T    L  V++AVG LR  +E+ LSM +  SPM  AR+R
Sbjct: 65  QIQTRLDAAGIESSFSKGLRITPQEHLSMVMEAVGGLRAYLESHLSMGLVNSPMHNARIR 124

Query: 123 VAGGNLVTARPIGVVEGVDYHHTGEVRRIDRKGIGRLLDERSIVLLSPLGYSPTGEIFNL 182
           V+GGN V A+P+GV++G+D+ HTG+VRR+D  GI +LL+   IVLL P+GYSPTG+ FNL
Sbjct: 125 VSGGNYVAAKPVGVLDGIDFGHTGKVRRVDVAGIEKLLELGHIVLLPPMGYSPTGDAFNL 184

Query: 183 ACEDVAMRAAIDLEAEKLILYGAEQGLLDASGKLVRELRPQQVPAHLQRLG-NSYQAELL 241
           + EDV  + A  L+AEKL+++  + GL +  G L+REL  +Q    L       + A+LL
Sbjct: 185 SYEDVGSQVAAALQAEKLMVFIDDPGLQEEDGTLIRELSARQASERLAAGAVTGHDADLL 244

Query: 242 DAAAQACRAGVKRSHIVSYTEDGALLSELFTRTGNGTLVAQEQFEQLREAGIEDVGGLIE 301
            AA  AC  GV+R+HI+SY +DGALL ELFTR G GTLV+ + +EQ R+A +ED+GG++E
Sbjct: 245 RAACDACVKGVRRAHIISYVDDGALLKELFTRDGAGTLVSGDHYEQFRQARVEDIGGILE 304

Query: 302 LIRPLEEQGILVRRSREVLEREIEQFSIVEREGLIIACAALYPIADSEAGELACLAVNPE 361
           LI+PLEEQGILVRRSRE+LE EI++F + ER+G I+ CAALY   +  AGEL+C AV+P 
Sbjct: 305 LIQPLEEQGILVRRSREMLETEIDRFVVAERDGTIVGCAALYSYPEEGAGELSCFAVDPT 364

Query: 362 YRHGGRGDELLERIEERARGLGLKTLFVLTTRTAHWFRERGFQPSSVERLPAARASLYNF 421
           YR  GRGDE+L  +E+ ARG G++ LFVLTT+T HWFRERGFQPS+V+ LP  + + YN 
Sbjct: 365 YRRAGRGDEILAMVEKLARGQGIQKLFVLTTQTEHWFRERGFQPSTVQALPGPKLAAYNT 424

Query: 422 QRNSQVFEKSL 432
           QRNS+VF K L
Sbjct: 425 QRNSKVFFKPL 435


Lambda     K      H
   0.321    0.138    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 558
Number of extensions: 23
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 432
Length of database: 435
Length adjustment: 32
Effective length of query: 400
Effective length of database: 403
Effective search space:   161200
Effective search space used:   161200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

Align candidate GFF3372 HP15_3314 (N-acetyllutamate synthase)
to HMM TIGR01890 (argA: amino-acid N-acetyltransferase (EC 2.3.1.1))

Software error:

../bin/blast/fastacmd -i /tmp/list.1665.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.1665.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.