Align asparagine synthetase B, glutamine-hydrolyzing; EC 6.3.5.4 (characterized)
to candidate GFF1957 HP15_1914 asparagine synthase, glutamine-hydrolyzing
Query= CharProtDB::CH_002444 (554 letters) >FitnessBrowser__Marino:GFF1957 Length = 632 Score = 147 bits (371), Expect = 1e-39 Identities = 122/394 (30%), Positives = 188/394 (47%), Gaps = 56/394 (14%) Query: 1 MCSIFGVFDIKT--DAVELRKKALELSRLMRHRGPDWSGIYASDNAILAHERLSIVDVN- 57 MC I G T D + A + + + HRGPD +G++ + L H+RLSI+D++ Sbjct: 1 MCGIAGFLRTGTLPDREQHHLWAERMGQAIAHRGPDANGVHIDQDVALVHQRLSILDLSS 60 Query: 58 AGAQPLYNQQKTHVLAVNGEIYNHQALRAEYG-DRYQFQTGSDCEVILALYQEKGPEFLD 116 AG QP+ + +++ NGEIYN ++LR D + F+T +D EV+LALY G L Sbjct: 61 AGNQPMASSCGRYIIVFNGEIYNFRSLREGLEQDGFSFKTQTDTEVLLALYARHGESCLR 120 Query: 117 DLQGMFAFALYDSEKDAYLIGRDHLGIIPLYMGYDEHGQLYVASEMKAL--VPVCR---- 170 L GMFAFA++D++ + IGRD LG PLY D GQ + SE+KAL PV R Sbjct: 121 QLNGMFAFAIWDAKTKSLFIGRDRLGKKPLYY-TDTDGQFFFGSEIKALFATPVVRPALR 179 Query: 171 --TIKEF-------------------PAGSYLWSQDGEIRSYYHRDWFDYDAVKDNVTD- 208 IK+F P G + +G I + D V+D Sbjct: 180 PDAIKDFFVYQYIPDPKTIYANVHKLPPGHCMEVCEGRISVRKYWDLSFRPVEGRTVSDI 239 Query: 209 KNELRQALEDSVKSHLMSDVPYGVLLSGGLDSSIISAITKKYAARRVEDQERSEAWWPQL 268 K L ++++V+ ++SDVP G LSGG+DSS + + +++ V Sbjct: 240 KAGLYDVIDEAVRLRMISDVPLGAFLSGGIDSSAVVGLMAGRSSQPVT------------ 287 Query: 269 HSFAVGLPGS--PDLKAAQEVANHLGTVHHEIHFTVQEGLDAIRDVIYHIETY--DVTTI 324 + +G ++K A VA T HH FTV+E + D + I + + Sbjct: 288 -TCTIGFDDEKFDEIKYADLVARQFKTDHHV--FTVKE---TVADNLVGISRFFDEPFAD 341 Query: 325 RASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGY 358 + P + +S+ + + + L+G+G DE F GY Sbjct: 342 PSFVPTFFVSQLARTQ-VTVALAGDGGDENFAGY 374 Score = 41.2 bits (95), Expect = 1e-07 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 2/67 (2%) Query: 388 RANKAMSAWGVEARVPFLDKKFLDVAMRINPQDKMCGNGKMEKHILRECFEAYLPASVAW 447 + ++ A +E R P LD + ++ A I K+ GN K KH+L+ECF L + + Sbjct: 497 KVDRMSMANSLETRAPLLDYRVVEYAAGIPSALKLKGNCK--KHVLKECFSDLLDEDILY 554 Query: 448 RQKEQFS 454 R+K FS Sbjct: 555 RKKMGFS 561 Lambda K H 0.319 0.135 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 797 Number of extensions: 41 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 554 Length of database: 632 Length adjustment: 37 Effective length of query: 517 Effective length of database: 595 Effective search space: 307615 Effective search space used: 307615 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory