Align 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 (characterized)
to candidate GFF492 HP15_480 3-dehydroquinate synthase
Query= SwissProt::U3KRF2 (445 letters) >FitnessBrowser__Marino:GFF492 Length = 364 Score = 395 bits (1016), Expect = e-115 Identities = 206/362 (56%), Positives = 260/362 (71%), Gaps = 6/362 (1%) Query: 84 VDVDLGDRSYPIYIGSGLLDQPDLLQRHVHGKRVLVVTNSTVAPIYLDKVVGALTNGNPN 143 + V+LG+RSYPI+IG GLL DL V G +V++VTN TVAP+YL++ P Sbjct: 8 LSVELGERSYPIFIGEGLLGTQDL-SAFVSGAQVMIVTNETVAPLYLERAKACF----PG 62 Query: 144 VSVESVILPDGEKYKNMDTLMKVFDKAIESRLDRRCTFVALGGGVIGDMCGYAAASFLRG 203 V++V+LPDGEK+K+ TL +FD +E R R+ T VALGGGV+GDM G+AAA + RG Sbjct: 63 KRVDTVVLPDGEKFKDWQTLNSIFDGLLEHRHTRKTTLVALGGGVVGDMAGFAAACYQRG 122 Query: 204 VNFIQIPTTVMAQVDSSVGGKTGINHRLGKNLIGAFYQPQCVLIDTDTLNTLPDRELASG 263 V FIQIPTT+++QVDSSVGGKTGINH LGKN+IGAF+QPQ VLIDT +L TLP RE+++G Sbjct: 123 VPFIQIPTTLLSQVDSSVGGKTGINHPLGKNMIGAFHQPQAVLIDTASLQTLPAREVSAG 182 Query: 264 LAEVVKYGLIRDANFFEWQEKNMPALMARDPSALAYAIKRSCENKAEVVSLDEKESGLRA 323 LAEV+KYGLIRD F W E++M AL++ DP ALA AI RSC KAE+V+LDE+E G+RA Sbjct: 183 LAEVIKYGLIRDQGFLGWLEEHMDALVSLDPEALAEAIFRSCACKAEIVALDEREGGIRA 242 Query: 324 TLNLGHTFGHAIETGFGYGQWLHGEAVAAGMVMAVDMSYRLGWIDESIVNRAHNILQQAK 383 LNLGHTFGHAIET GYG WLHGEAV GM+MA ++S G I +R + ++ +A Sbjct: 243 ILNLGHTFGHAIETYAGYGNWLHGEAVGTGMLMAAELSALEGMISRDDCDRINRLILRAG 302 Query: 384 LPTAPPETMTVEMFKSVMAVDKKVADGLLRLILLKGPLGNCVFTGDYDRKALDETLHAFC 443 LP PP MT + F +MAVDKK DGLLRLILL+ +G+ V T + + L T FC Sbjct: 303 LPDKPPVAMTADDFMGLMAVDKKNVDGLLRLILLRS-VGDAVVTSEASPENLALTFARFC 361 Query: 444 KS 445 S Sbjct: 362 SS 363 Lambda K H 0.318 0.133 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 364 Length adjustment: 31 Effective length of query: 414 Effective length of database: 333 Effective search space: 137862 Effective search space used: 137862 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate GFF492 HP15_480 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.32739.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-118 380.0 0.0 6.2e-118 379.9 0.0 1.0 1 lcl|FitnessBrowser__Marino:GFF492 HP15_480 3-dehydroquinate syntha Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF492 HP15_480 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 379.9 0.0 6.2e-118 6.2e-118 1 337 [. 17 351 .. 17 358 .. 0.95 Alignments for each domain: == domain 1 score: 379.9 bits; conditional E-value: 6.2e-118 TIGR01357 1 ykvkvgegllk.klveelaekasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsletvaklldql 75 y++ +gegll + +++ + +++++t+e+v+ l+ e+ ++ g +v+++v+pdge+ K+++t++++ d l lcl|FitnessBrowser__Marino:GFF492 17 YPIFIGEGLLGtQDLSAFVS-GAQVMIVTNETVAPLYLERAKACFP--GKRVDTVVLPDGEKFKDWQTLNSIFDGL 89 57889999998655555553.689*************988888874..8*************************** PP TIGR01357 76 leeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlplgkNliGafyqPkaVl 151 le+ ++rk++lva+GGGvvgD+aGF+Aa y+RG++++q+PTtll++vDssvGGKtgin+plgkN+iGaf+qP+aVl lcl|FitnessBrowser__Marino:GFF492 90 LEHRHTRKTTLVALGGGVVGDMAGFAAACYQRGVPFIQIPTTLLSQVDSSVGGKTGINHPLGKNMIGAFHQPQAVL 165 **************************************************************************** PP TIGR01357 152 idlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelealeelikrsievKaevVeeDekesgl 227 id++ l+tlp re+++G+aEviK+gli d+ ++ +le++ ++l++l + eal+e+i+rs+ +Kae+V+ De+e g+ lcl|FitnessBrowser__Marino:GFF492 166 IDTASLQTLPAREVSAGLAEVIKYGLIRDQGFLGWLEEHMDALVSL-DPEALAEAIFRSCACKAEIVALDEREGGI 240 *****************************************99976.55*************************** PP TIGR01357 228 RalLNfGHtlgHaiEallkyk.lsHGeaVaiGmvveaklseklgllkaellerlvallkklglptklkkklsveel 302 Ra+LN+GHt+gHaiE+ ++y+ + HGeaV +Gm ++a+ls g++++++ +r+ +l+ ++glp k + ++++ + lcl|FitnessBrowser__Marino:GFF492 241 RAILNLGHTFGHAIETYAGYGnWLHGEAVGTGMLMAAELSALEGMISRDDCDRINRLILRAGLPDKPPVAMTADDF 316 **************************************************************************** PP TIGR01357 303 lkallkDKKnegskiklvlleeiGkaalasevtee 337 + + DKKn ++ ++l+ll+++G+a+++se + e lcl|FitnessBrowser__Marino:GFF492 317 MGLMAVDKKNVDGLLRLILLRSVGDAVVTSEASPE 351 **************************999876554 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (364 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.41 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory