Align cystathionine gamma-lyase; EC 4.4.1.1 (characterized)
to candidate GFF659 HP15_641 homocysteine synthase
Query= CharProtDB::CH_122519 (419 letters) >FitnessBrowser__Marino:GFF659 Length = 425 Score = 221 bits (563), Expect = 3e-62 Identities = 148/423 (34%), Positives = 216/423 (51%), Gaps = 44/423 (10%) Query: 29 TLAVHAGAPHDPTTGAVIAPISLSTTFAQESVGKPVGLYE-------YTRSSNPNRDNFE 81 TLA+HAG DPTT A PI +T++ + L++ YTR NP E Sbjct: 5 TLALHAGFKSDPTTRAATTPIYQTTSYTFDDTQHGADLFDLKVQGNIYTRIMNPTNAVLE 64 Query: 82 EAVASLEHAKYALAFSSGSATTATILHSLAP-GSHVVSVSDVYGGTHRYFTKVAAAHGVN 140 E +A LE ALA +SG A L ++ G+++VS S +YGGT+ F G+ Sbjct: 65 ERMAELEGGVGALAVASGMAAITYALQTICKVGNNIVSTSQLYGGTYNLFAHSLPNQGIE 124 Query: 141 VSFSSCLELD-VEKLIRPNETKLVWIETPSNPTLALVDIRKVAAVAHRHGVLVVVDNTFM 199 + D VEK I N T+ ++ E+ NP +VDI++ A +AH+HG+ ++VDNT Sbjct: 125 CKMVRHDDFDAVEKAIDEN-TRALFCESIGNPAGNVVDIQRWAEIAHKHGIPLMVDNTVA 183 Query: 200 SPYVQNPLDHGADVVIHSVTKYINGHSDVLMGVAA----FNSDELKERFTFLQNA----- 250 +P++ P++HGAD+VIHS+TKYI GH + GV F+ ++F L Sbjct: 184 TPFLCRPIEHGADIVIHSLTKYIGGHGTTVAGVVVDSGKFDWKASADKFPMLNEPDPSYH 243 Query: 251 ------------------------IGAVPSPFDCWLAHRGLKTLHLRAREATANATAVAL 286 GA +PF+ +L +GL+TL LR NA VA Sbjct: 244 GVVYTDALGPAAFIGRCRVVPLRNTGAALAPFNAFLIMQGLETLALRMERHCENAEKVAN 303 Query: 287 ALESSPHVISVNYPGLNSHPNREIAVKQHRKGMGGGMLSFRIKGGHKAAHLFCEYTKIFT 346 L+ P V VNY L + P + K G G+LSF IKGG +A F + ++ Sbjct: 304 FLQEHPSVEWVNYATLANSPYKATCEK-ISGGKASGILSFGIKGGREAGAKFIDALELIL 362 Query: 347 LAESLGGVESLCEVPSSMTHAGIPKEEREAAGVYDDLVRMSCGIEDVEDLTADTMQALER 406 ++G +SL P++ TH + EE ++AGV +DLVR+S GIE V+D+ AD QAL++ Sbjct: 363 RLVNIGDAKSLACHPATTTHRQLNPEELKSAGVSEDLVRLSIGIEHVDDIIADITQALDK 422 Query: 407 AVA 409 A A Sbjct: 423 AQA 425 Lambda K H 0.316 0.130 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 502 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 419 Length of database: 425 Length adjustment: 32 Effective length of query: 387 Effective length of database: 393 Effective search space: 152091 Effective search space used: 152091 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory