Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate GFF2144 HP15_2098 erythronate-4-phosphate dehydrogenase
Query= BRENDA::C3SVM7 (410 letters) >FitnessBrowser__Marino:GFF2144 Length = 383 Score = 88.2 bits (217), Expect = 4e-22 Identities = 81/261 (31%), Positives = 121/261 (46%), Gaps = 37/261 (14%) Query: 49 ESIRDAHFIGLRSRTHLTEDVINAAEKLVAIGCFCIGTNQVDLDAAAKRGIPVFNAPFSN 108 E +RDA + +RS T + +++ + ++ +G IGT+ VDLD GI AP N Sbjct: 33 EDVRDADIVLVRSVTRVNRELLEGS-RVRFVGTTTIGTDHVDLDWLEAAGIRFSAAPGCN 91 Query: 109 TRSVAELVIGELLLLL--RGVPEANAKAHRGVWNKLAAGSFEARGKKLGIIGYGHIGTQL 166 SVAE V+ L L RG+ + W++L+ +GI+G G++G +L Sbjct: 92 ANSVAEYVLSVLSLHAERRGLAD---------WSQLS----------VGIVGVGNVGGEL 132 Query: 167 GILAESLGMYVYFYDIENKLPLGNATQVQHLSDLLNMSDVVSLHVP-----ENPSTKNMM 221 E LG V D + L + + DVVSLH P ++P T +M+ Sbjct: 133 AHKLERLGFDVRLCDPPRADREEEDQEFVSLEEAMKC-DVVSLHTPLTREGDHP-TLHMI 190 Query: 222 GAKEISLMKPGSLLINASRGTVVDIPALCDALASKHLAGAAIDVFPTEPATNSDPFTSPL 281 G E+ + LLINA RG V+D AL L + A+DV+ EP + + Sbjct: 191 GHPELEALGANQLLINAGRGEVIDSSALLARLDQGNAPTVALDVWEQEPRIHPE------ 244 Query: 282 CEFDNV-LLTPHIGGSTQEAQ 301 D V L TPHI G + E + Sbjct: 245 -LVDRVWLATPHIAGYSLEGK 264 Lambda K H 0.318 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 383 Length adjustment: 31 Effective length of query: 379 Effective length of database: 352 Effective search space: 133408 Effective search space used: 133408 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory