Align 3-isopropylmalate dehydratase subunit LeuD (EC 4.2.1.33) (characterized)
to candidate GFF2654 HP15_2598 isopropylmalate isomerase small subunit
Query= ecocyc::LEUD-MONOMER (201 letters) >FitnessBrowser__Marino:GFF2654 Length = 211 Score = 210 bits (534), Expect = 2e-59 Identities = 106/201 (52%), Positives = 138/201 (68%), Gaps = 7/201 (3%) Query: 3 EKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFNDWRFLDE-------KGQ 55 E F HTGLVVP D +NVDTDAI+PKQ+L+ + +TGF LF+D R+LD + Sbjct: 2 EAFKTHTGLVVPFDRSNVDTDAILPKQYLKMLEKTGFADFLFDDERYLDPGDVDIPVSER 61 Query: 56 QPNPDFVLNFPQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAPSFADIFYGNSF 115 +P+PDF+LN Y ASILLAR NFGCGSSREHA WAL D+G + VIA SF DIF+ N F Sbjct: 62 RPDPDFILNRAPYDRASILLARANFGCGSSREHAVWALKDFGVRAVIASSFGDIFFNNCF 121 Query: 116 NNQLLPVKLSDAEVDELFALVKANPGIHFDVDLEAQEVKAGEKTYRFTIDAFRRHCMMNG 175 NN LLPV L ++ +DELF L G+ VDLE E+++ +KT+RF +++ RR +++G Sbjct: 122 NNGLLPVILDESTIDELFNLASDTDGLELTVDLEQCEIRSPKKTWRFVVESGRRENLLSG 181 Query: 176 LDSIGLTLQHDDAIAAYEAKQ 196 LD IG TL +I AYEA + Sbjct: 182 LDEIGRTLTFSGSIQAYEANR 202 Lambda K H 0.322 0.138 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 211 Length adjustment: 21 Effective length of query: 180 Effective length of database: 190 Effective search space: 34200 Effective search space used: 34200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate GFF2654 HP15_2598 (isopropylmalate isomerase small subunit)
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
../bin/blast/fastacmd -i /tmp/list.27713.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.27713.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.