GapMind for Amino acid biosynthesis

 

Alignments for a candidate for leuD in Marinobacter adhaerens HP15

Align 3-isopropylmalate dehydratase small subunit; EC 4.2.1.33 (characterized, see rationale)
to candidate GFF2654 HP15_2598 isopropylmalate isomerase small subunit

Query= uniprot:Q845W4
         (216 letters)



>FitnessBrowser__Marino:GFF2654
          Length = 211

 Score =  221 bits (564), Expect = 6e-63
 Identities = 109/210 (51%), Positives = 144/210 (68%), Gaps = 1/210 (0%)

Query: 1   MEKFTVHTGVVAPLDRENVDTDAIIPKQFLKSIKRTGFGPNAFDEWRYLDHGEPGQDNSK 60
           ME F  HTG+V P DR NVDTDAI+PKQ+LK +++TGF    FD+ RYLD G+     S+
Sbjct: 1   MEAFKTHTGLVVPFDRSNVDTDAILPKQYLKMLEKTGFADFLFDDERYLDPGDVDIPVSE 60

Query: 61  RPLNPDFVLNQPRYQGASILVTRKNFGCGSSREHAPWALQQYGFRAIIAPSFADIFFNNC 120
           R  +PDF+LN+  Y  ASIL+ R NFGCGSSREHA WAL+ +G RA+IA SF DIFFNNC
Sbjct: 61  RRPDPDFILNRAPYDRASILLARANFGCGSSREHAVWALKDFGVRAVIASSFGDIFFNNC 120

Query: 121 FKNGLLPIVLTEQQVDHLINETVAFNGYQLTIDLEAQVVRTPDGRDYPFEITAFRKYCLL 180
           F NGLLP++L E  +D L N     +G +LT+DLE   +R+P  + + F + + R+  LL
Sbjct: 121 FNNGLLPVILDESTIDELFNLASDTDGLELTVDLEQCEIRSPK-KTWRFVVESGRRENLL 179

Query: 181 NGFDDIGLTLRHADKIRQFEAERLAKQPWL 210
           +G D+IG TL  +  I+ +EA R   +PWL
Sbjct: 180 SGLDEIGRTLTFSGSIQAYEANRRTLEPWL 209


Lambda     K      H
   0.322    0.141    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 192
Number of extensions: 6
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 216
Length of database: 211
Length adjustment: 22
Effective length of query: 194
Effective length of database: 189
Effective search space:    36666
Effective search space used:    36666
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)

Align candidate GFF2654 HP15_2598 (isopropylmalate isomerase small subunit)
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00171.hmm
# target sequence database:        /tmp/gapView.29097.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00171  [M=188]
Accession:   TIGR00171
Description: leuD: 3-isopropylmalate dehydratase, small subunit
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
    1.4e-70  223.0   0.0    1.7e-70  222.8   0.0    1.0  1  lcl|FitnessBrowser__Marino:GFF2654  HP15_2598 isopropylmalate isomer


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Marino:GFF2654  HP15_2598 isopropylmalate isomerase small subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  222.8   0.0   1.7e-70   1.7e-70       1     184 [.       1     191 [.       1     195 [. 0.94

  Alignments for each domain:
  == domain 1  score: 222.8 bits;  conditional E-value: 1.7e-70
                           TIGR00171   1 mkefkkltGlvvpldkanvdtdaiipkqflkkikrtGfgkhlfyewryld.......ekGkepnpefvlnvpqyq 68 
                                         m+ fk++tGlvvp+d+ nvdtdai+pkq+lk +++tGf  +lf + ryld       +  + p+p+f+ln  +y 
  lcl|FitnessBrowser__Marino:GFF2654   1 MEAFKTHTGLVVPFDRSNVDTDAILPKQYLKMLEKTGFADFLFDDERYLDpgdvdipVSERRPDPDFILNRAPYD 75 
                                         899**********************************************73333333346789************ PP

                           TIGR00171  69 gasillarenfGcGssrehapwalkdyGfkviiapsfadifynnsfkngllpirlseeeveellalvk.nkglkl 142
                                          asillar nfGcGssreha walkd+G++ +ia sf+dif+nn+f+ngllp+ l+e++++el++l +  +gl+l
  lcl|FitnessBrowser__Marino:GFF2654  76 RASILLARANFGCGSSREHAVWALKDFGVRAVIASSFGDIFFNNCFNNGLLPVILDESTIDELFNLASdTDGLEL 150
                                         *****************************************************************999799**** PP

                           TIGR00171 143 tvdleaqkvkdsegkvysfeidefrkhcllnGldeigltlqk 184
                                         tvdle+ ++++ + k+ +f +++ r++ ll Gldeig tl  
  lcl|FitnessBrowser__Marino:GFF2654 151 TVDLEQCEIRSPK-KTWRFVVESGRRENLLSGLDEIGRTLTF 191
                                         **********999.************************9975 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (188 nodes)
Target sequences:                          1  (211 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 8.48
//
[ok]

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory