Align dihydrodipicolinate reductase; EC 1.3.1.26 (characterized)
to candidate GFF3137 HP15_3079 dihydrodipicolinate reductase
Query= CharProtDB::CH_002128 (273 letters) >FitnessBrowser__Marino:GFF3137 Length = 266 Score = 333 bits (853), Expect = 3e-96 Identities = 167/265 (63%), Positives = 203/265 (76%) Query: 6 IRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSS 65 +RVAI GA GRMG+ LI+A EG++LGAA+ GSSL+G+DAGE+ G GKTGV + S Sbjct: 1 MRVAIIGAAGRMGKVLIEAVDGTEGLELGAAVVEPGSSLIGADAGEMTGIGKTGVKMAGS 60 Query: 66 LDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAADIAIVF 125 L VKDDFDV +DFT P+ TL + FC+ +GK +VIGTTG +A KQ + AA A+VF Sbjct: 61 LADVKDDFDVLVDFTFPDLTLENAEFCKANGKMLVIGTTGMSDAEKQQLALAAESTAVVF 120 Query: 126 AANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAHALDKD 185 A N SVGVNV+L LL AA +GD D+EIIEAHHRHK DAPSGTAL MGE +A AL +D Sbjct: 121 APNMSVGVNVVLNLLRTAAATLGDDYDVEIIEAHHRHKKDAPSGTALRMGEVVADALGRD 180 Query: 186 LKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSRMTFAN 245 LK+CAVY REG TGER IGF T+RAGD+VG+HT +FA GER+E+THKASSRMTFA Sbjct: 181 LKECAVYGREGFTGERTRKEIGFETIRAGDVVGDHTVLFATEGERIEVTHKASSRMTFAK 240 Query: 246 GAVRSALWLSGKESGLFDMRDVLDL 270 GA+R+ALWL K +GL+DM+DVLDL Sbjct: 241 GAMRAALWLKDKPAGLYDMQDVLDL 265 Lambda K H 0.319 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 266 Length adjustment: 25 Effective length of query: 248 Effective length of database: 241 Effective search space: 59768 Effective search space used: 59768 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate GFF3137 HP15_3079 (dihydrodipicolinate reductase)
to HMM TIGR00036 (dapB: 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00036.hmm # target sequence database: /tmp/gapView.14206.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00036 [M=270] Accession: TIGR00036 Description: dapB: 4-hydroxy-tetrahydrodipicolinate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-106 342.3 4.3 1.2e-106 342.1 4.3 1.0 1 lcl|FitnessBrowser__Marino:GFF3137 HP15_3079 dihydrodipicolinate re Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF3137 HP15_3079 dihydrodipicolinate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 342.1 4.3 1.2e-106 1.2e-106 2 270 .] 1 264 [. 1 264 [. 0.98 Alignments for each domain: == domain 1 score: 342.1 bits; conditional E-value: 1.2e-106 TIGR00036 2 ikvavaGaaGrmGrevikavkeaedlelvaalerkgsskqgkDiGelagigkvgvpveddleavkvlaekkadvl 76 ++va+ GaaGrmG+ +i+av +e+lel+aa+ +gss+ g D+Ge++gigk+gv++ +l v ++++dvl lcl|FitnessBrowser__Marino:GFF3137 1 MRVAIIGAAGRMGKVLIEAVDGTEGLELGAAVVEPGSSLIGADAGEMTGIGKTGVKMAGSLADV----KDDFDVL 71 89*****************************************************999999877....******* PP TIGR00036 77 iDfttpeavlenvkialekgvrlVvGTTGfseedlkelkdlaekkgvalviapNfaiGvnlllkllekaakvle. 150 +Dft p+ +len++++ ++g+ lV+GTTG+s++++++l+ +ae +a+v+apN+++Gvn++l ll++aa +l+ lcl|FitnessBrowser__Marino:GFF3137 72 VDFTFPDLTLENAEFCKANGKMLVIGTTGMSDAEKQQLALAAES--TAVVFAPNMSVGVNVVLNLLRTAAATLGd 144 ***************************************99999..************************99972 PP TIGR00036 151 dvDiEiiElHHrhKkDaPSGTAlklaeiiakargkdlkeaaveeregltGerkkeeiGiaavRggdvvgehtvlF 225 d+D+EiiE+HHrhKkDaPSGTAl+++e++a+a g+dlke+av++reg+tGer+++eiG+ ++R+gdvvg+htvlF lcl|FitnessBrowser__Marino:GFF3137 145 DYDVEIIEAHHRHKKDAPSGTALRMGEVVADALGRDLKECAVYGREGFTGERTRKEIGFETIRAGDVVGDHTVLF 219 57************************************************************************* PP TIGR00036 226 asdGerleitHkassRaafakGvvrairwledkeekvydledvld 270 a++Ger+e+tHkassR++fakG++ra+ wl+dk +++yd++dvld lcl|FitnessBrowser__Marino:GFF3137 220 ATEGERIEVTHKASSRMTFAKGAMRAALWLKDKPAGLYDMQDVLD 264 *******************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (266 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.62 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory