Align [amino group carrier protein]-gamma-(L-lysyl)-L-glutamate aminotransferase (EC 2.6.1.118) (characterized)
to candidate GFF3766 HP15_3708 4-aminobutyrate aminotransferase
Query= BRENDA::Q93R93 (395 letters) >FitnessBrowser__Marino:GFF3766 Length = 425 Score = 190 bits (483), Expect = 6e-53 Identities = 136/415 (32%), Positives = 206/415 (49%), Gaps = 41/415 (9%) Query: 16 EKTLDSGVYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAE 75 E+ + +G + ++ A +WDA+G ID GG GV N+GH +P+VVEAVK Q + Sbjct: 11 ERYVAAGAASPNEQFADHATNAELWDADGKRMIDFAGGIGVLNIGHRHPKVVEAVKAQLD 70 Query: 76 TLMAMPQTLPTPMRG--EFYRTLTAILPPELN-RVFPVNSGTEANEAALKFARAHTGRKK 132 LM QT+ P G + L+ ++P + +V NSG EA E A+K ARA TG+ Sbjct: 71 KLMHTCQTV-MPYEGYVKLAEKLSGVVPVRGHAKVMLANSGAEALENAMKIARAATGKTN 129 Query: 133 FVAAMRGFSGRTMGSLSVTWEPK-YREPFLPLVEPVEFIPY----------NDVEALKRA 181 + G+ GRT ++++ + Y+ F P+ V PY + LK A Sbjct: 130 VICFDGGYHGRTFYTMAMNGKAAPYQTDFGPMPGTVYRAPYPVPYHGVSEDEALRGLKMA 189 Query: 182 VDEE-----TAAVILEPVQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGK 236 + + TAA+++EPV GEGG A FL+ R+I E L+I DE+Q+G GRTGK Sbjct: 190 MKADSPAHNTAAIVIEPVLGEGGFYAAPTSFLKEIRKICDENDILMIADEVQSGFGRTGK 249 Query: 237 RFAFEHFGIVPDILTLAKALGGGVPLGVAVMREEVARSMPKGGHGTTFGGNPLAMAAGVA 296 FA EH G+ PD++T+AK++ G+P+ V ++ + G T+ G+P A AA +A Sbjct: 250 MFAIEHSGVEPDLMTMAKSMADGMPISAIVGTDKYMDASGPNSLGGTYTGSPTACAAALA 309 Query: 297 AIRYLERTRLWERAAELGPWFMEKLRAIPS------PKIREVRGMGLMVGLEL------- 343 + + ++ LG EKL+ S + VR +G M EL Sbjct: 310 VFDVFKEEDILGKSQALG----EKLKQRFSQWQEQFAHVDNVRNLGPMAAFELVESKESR 365 Query: 344 --KEKAAPYIARLEKEHRVLALQAG--PTVIRFLPPLVIEKEDLERVVEAVRAVL 394 K + A + + KE ++ L G +RFL P+ IE E LE + V L Sbjct: 366 TPKPELAAAVTKKAKEKGLILLSCGMYGNTLRFLMPVTIEDEVLEEGLAIVEESL 420 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 429 Number of extensions: 28 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 425 Length adjustment: 31 Effective length of query: 364 Effective length of database: 394 Effective search space: 143416 Effective search space used: 143416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory