Align Homoserine O-acetyltransferase; HAT; EC 2.3.1.31; Homoserine transacetylase; HTA (uncharacterized)
to candidate GFF3215 HP15_3157 homoserine O-acetyltransferase
Query= curated2:Q5NR05 (373 letters) >FitnessBrowser__Marino:GFF3215 Length = 343 Score = 98.6 bits (244), Expect = 2e-25 Identities = 72/214 (33%), Positives = 103/214 (48%), Gaps = 21/214 (9%) Query: 17 GELALDGGSLLTGIEIAYETYGHLNADASNAILICHPLTADQFAASDHPITGKPGWWSRM 76 G+L L G L + Y G LNA N I++ P AA +HP W R Sbjct: 14 GDLPLTSGETLHSARLRYHRIGELNAPKDNLIML--PTYYGGAAAGNHP-------WVR- 63 Query: 77 IGKGKPIDPERYCIICSNVLGSCLGSTGPSSFTPGTETPYAMNFPVITIRDMVRAQAKLL 136 P+DP+RYCI+ +LG+ G + S T G + FP +++ D V Q +L+ Sbjct: 64 --GNSPLDPDRYCIVIPALLGA--GESSSPSNTAGAQG--GPGFPSVSLYDNVMLQKRLV 117 Query: 137 -DYLGIRQLKAVIGGSMGGMQALEWASTYPDRVKSVVIIASTARHSAQNIAFHEVGRQAI 195 D G ++ V+G SMGGMQAL+W +P +V++V+ TAR N F E + A+ Sbjct: 118 EDIFGDARIALVMGWSMGGMQALQWGCLFPTQVRAVLATCCTARCYPHNRVFLEGVKAAL 177 Query: 196 MADPKWRQGNYYEEKDPPVAGL-AVARMAAHITY 228 D + G Y + PP GL A R+ A Y Sbjct: 178 TCDHAFENGRY---RTPPELGLRAFGRVYAGWAY 208 Lambda K H 0.321 0.136 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 336 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 343 Length adjustment: 29 Effective length of query: 344 Effective length of database: 314 Effective search space: 108016 Effective search space used: 108016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory