Align Ornithine aminotransferase; Ornithine--oxo-acid aminotransferase; EC 2.6.1.13 (characterized)
to candidate GFF3915 HP15_3855 2,4-diaminobutyrate 4-transaminase
Query= SwissProt::Q6CWC1 (437 letters) >FitnessBrowser__Marino:GFF3915 Length = 422 Score = 172 bits (436), Expect = 2e-47 Identities = 135/412 (32%), Positives = 214/412 (51%), Gaps = 29/412 (7%) Query: 30 PVVFSRASGAHVWDPEGKEYLDFLSAYSAVNQGHCHPHIIQALVD--QASKLTLSSRAFS 87 PV+F+RA AH++ +GKEYLDFL+ ++N GH + + +AL++ +A ++ F+ Sbjct: 19 PVIFNRAKNAHLYTEDGKEYLDFLAGAGSLNYGHNNDTLKKALLEYIEADGVSQGLDMFT 78 Query: 88 ---NDCFASFSKFVTEFFG--YESVLPMNTGAEAVESALKLARRWGYMVKKIQPNEAIIL 142 +D S+ K + + G Y+ TG VE+ALKLAR K++ II Sbjct: 79 TAKHDFMESYKKHILDPRGLDYKMQFTGPTGTNCVEAALKLAR-------KVKGRSGIIS 131 Query: 143 GARGNFHGRTFGAISLSTDEEDSRMNFGPFLENVTAKIPGGSDDEFIRYGEIDDYKRAFE 202 G FHG T GA++ +T + R G L NV G + + I D + Sbjct: 132 FTNG-FHGVTMGAVA-TTGNKHHRGGVGTPLGNVDFMFYDGYLGDDVDTLAIMDKLLSDG 189 Query: 203 SHGDKI-CAVIVEPIQGEAGIVVPRADFLTDLQELCKKHQVLLICDEIQTGIARTGKLLC 261 S G ++ AVIVE +QGE G+ RA++L L ELCKKH +LLI D+IQ G RTG+ Sbjct: 190 SSGFELPAAVIVEAVQGEGGLNACRAEWLKGLSELCKKHDILLILDDIQAGNGRTGEFFS 249 Query: 262 YEHSPNCKPDIILLGKAISGGVLPVSCVLSSREIMDCFTPGSHGSTYGGNPLASRVAIAA 321 +E + KPDI+ + K++SG LP++ VL E +D + PG H T+ GN +A A AA Sbjct: 250 FEFA-GIKPDIVTVSKSLSGYGLPMALVLFKPE-LDVWDPGEHNGTFRGNNMAFITARAA 307 Query: 322 LEVVQNENLVERSARL-GKFLQDELVKLQHESNGVISEVRGKGLLTAIVINPEKANG--- 377 +E ++ + + L D L + + G +++G+GL+ I G Sbjct: 308 VENYWKDDAFANEVKAKTEVLGDALQSICDKYPGQF-KMKGRGLMRGIEAKHADITGPIT 366 Query: 378 RTAWDLCLLMKDQGVLAKPTHEHIIRLAPPLVISEEDLLKGVDSIRVSLSKL 429 + A++ L+++ G ++ +I+ PL SEEDL KG + S+ ++ Sbjct: 367 KRAFEHGLIIETSG-----PNDEVIKCLMPLTTSEEDLKKGAALLAKSVDEI 413 Lambda K H 0.318 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 467 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 437 Length of database: 422 Length adjustment: 32 Effective length of query: 405 Effective length of database: 390 Effective search space: 157950 Effective search space used: 157950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory