Align amino-acid N-acetyltransferase (EC 2.3.1.1) (characterized)
to candidate GFF3372 HP15_3314 N-acetyllutamate synthase
Query= BRENDA::P22567 (432 letters) >FitnessBrowser__Marino:GFF3372 Length = 435 Score = 476 bits (1226), Expect = e-139 Identities = 234/431 (54%), Positives = 316/431 (73%), Gaps = 1/431 (0%) Query: 3 DYVNWLRHASPYINSHRDRTFVVMLPGEGVEHPNFGNIVHDLVLLHSLGARLVLVHGSRP 62 D+++ RH+SPYIN+HR RT V+ +PG+ +EH NF NI+HD+ LL SLG RLV+ G+RP Sbjct: 5 DWLHGFRHSSPYINAHRGRTVVLTIPGDAIEHGNFINIIHDIALLSSLGVRLVVAFGARP 64 Query: 63 QIEARLAARGLAPRYHRDLRVTDAPTLECVIDAVGSLRIAIEARLSMDMAASPMQGARLR 122 QI+ RL A G+ + + LR+T L V++AVG LR +E+ LSM + SPM AR+R Sbjct: 65 QIQTRLDAAGIESSFSKGLRITPQEHLSMVMEAVGGLRAYLESHLSMGLVNSPMHNARIR 124 Query: 123 VAGGNLVTARPIGVVEGVDYHHTGEVRRIDRKGIGRLLDERSIVLLSPLGYSPTGEIFNL 182 V+GGN V A+P+GV++G+D+ HTG+VRR+D GI +LL+ IVLL P+GYSPTG+ FNL Sbjct: 125 VSGGNYVAAKPVGVLDGIDFGHTGKVRRVDVAGIEKLLELGHIVLLPPMGYSPTGDAFNL 184 Query: 183 ACEDVAMRAAIDLEAEKLILYGAEQGLLDASGKLVRELRPQQVPAHLQRLG-NSYQAELL 241 + EDV + A L+AEKL+++ + GL + G L+REL +Q L + A+LL Sbjct: 185 SYEDVGSQVAAALQAEKLMVFIDDPGLQEEDGTLIRELSARQASERLAAGAVTGHDADLL 244 Query: 242 DAAAQACRAGVKRSHIVSYTEDGALLSELFTRTGNGTLVAQEQFEQLREAGIEDVGGLIE 301 AA AC GV+R+HI+SY +DGALL ELFTR G GTLV+ + +EQ R+A +ED+GG++E Sbjct: 245 RAACDACVKGVRRAHIISYVDDGALLKELFTRDGAGTLVSGDHYEQFRQARVEDIGGILE 304 Query: 302 LIRPLEEQGILVRRSREVLEREIEQFSIVEREGLIIACAALYPIADSEAGELACLAVNPE 361 LI+PLEEQGILVRRSRE+LE EI++F + ER+G I+ CAALY + AGEL+C AV+P Sbjct: 305 LIQPLEEQGILVRRSREMLETEIDRFVVAERDGTIVGCAALYSYPEEGAGELSCFAVDPT 364 Query: 362 YRHGGRGDELLERIEERARGLGLKTLFVLTTRTAHWFRERGFQPSSVERLPAARASLYNF 421 YR GRGDE+L +E+ ARG G++ LFVLTT+T HWFRERGFQPS+V+ LP + + YN Sbjct: 365 YRRAGRGDEILAMVEKLARGQGIQKLFVLTTQTEHWFRERGFQPSTVQALPGPKLAAYNT 424 Query: 422 QRNSQVFEKSL 432 QRNS+VF K L Sbjct: 425 QRNSKVFFKPL 435 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 558 Number of extensions: 23 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 435 Length adjustment: 32 Effective length of query: 400 Effective length of database: 403 Effective search space: 161200 Effective search space used: 161200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate GFF3372 HP15_3314 (N-acetyllutamate synthase)
to HMM TIGR01890 (argA: amino-acid N-acetyltransferase (EC 2.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01890.hmm # target sequence database: /tmp/gapView.16336.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01890 [M=429] Accession: TIGR01890 Description: N-Ac-Glu-synth: amino-acid N-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-174 565.1 0.0 5.8e-174 565.0 0.0 1.0 1 lcl|FitnessBrowser__Marino:GFF3372 HP15_3314 N-acetyllutamate synth Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF3372 HP15_3314 N-acetyllutamate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 565.0 0.0 5.8e-174 5.8e-174 3 429 .] 8 435 .] 6 435 .] 0.98 Alignments for each domain: == domain 1 score: 565.0 bits; conditional E-value: 5.8e-174 TIGR01890 3 kwlreaaPyinahrdktlvvglggelvedknlgklvadiallhslGvrlvlvhGarpqieerlakrgrtthyvrG 77 +++r+++Pyinahr++t+v++++g+++e++n+ ++++diall+slGvrlv+ Garpqi+ rl++ g+++ + +G lcl|FitnessBrowser__Marino:GFF3372 8 HGFRHSSPYINAHRGRTVVLTIPGDAIEHGNFINIIHDIALLSSLGVRLVVAFGARPQIQTRLDAAGIESSFSKG 82 68************************************************************************* PP TIGR01890 78 lrvtdeaslelvkeaaGelrlaiearlsmslantpmagsrlsvvsGnfvtarPiGvveGvdyehtGevrkidaeg 152 lr+t + l +v+ea+G lr +e++lsm l n+pm +r++v Gn+v a+P+Gv++G+d+ htG+vr++d++g lcl|FitnessBrowser__Marino:GFF3372 83 LRITPQEHLSMVMEAVGGLRAYLESHLSMGLVNSPMHNARIRVSGGNYVAAKPVGVLDGIDFGHTGKVRRVDVAG 157 *************************************************************************** PP TIGR01890 153 irrlldersivllsPlgfsvtGeifnlamedvatsvaiklkadklillteedGildadGklvaelsaqev.eslv 226 i++ll+ ++ivll+P+g+s+tG++fnl+ edv ++va +l+a+kl+++ ++G+ ++dG+l++elsa+++ e+l+ lcl|FitnessBrowser__Marino:GFF3372 158 IEKLLELGHIVLLPPMGYSPTGDAFNLSYEDVGSQVAAALQAEKLMVFIDDPGLQEEDGTLIRELSARQAsERLA 232 ******************************************************************988725667 PP TIGR01890 227 erleeettarllsaavkalrgGvarshlvsyaedGallqelftrdGiGtlvskealesireatiddvggilelir 301 + + a ll+aa +a+ Gv+r+h++sy dGall+elftrdG Gtlvs +++e+ r+a ++d+ggileli+ lcl|FitnessBrowser__Marino:GFF3372 233 AGAVTGHDADLLRAACDACVKGVRRAHIISYVDDGALLKELFTRDGAGTLVSGDHYEQFRQARVEDIGGILELIQ 307 77888889******************************************************************* PP TIGR01890 302 PleeqGilvrrsrellereieefsviekdGliigcaalypyaeeevgelaclavsPeardggrGerllkhiedra 376 PleeqGilvrrsre+le ei++f v e+dG+i+gcaaly+y+ee++gel+c+av+P +r +grG+++l+ +e+ a lcl|FitnessBrowser__Marino:GFF3372 308 PLEEQGILVRRSREMLETEIDRFVVAERDGTIVGCAALYSYPEEGAGELSCFAVDPTYRRAGRGDEILAMVEKLA 382 *************************************************************************** PP TIGR01890 377 rqvGlkrlfvlttrtehWfrerGfaeasvdelPearrklynyqrrskilvkkl 429 r+ G+++lfvltt+tehWfrerGf++++v++lP + yn qr+sk++ k+l lcl|FitnessBrowser__Marino:GFF3372 383 RGQGIQKLFVLTTQTEHWFRERGFQPSTVQALPGPKLAAYNTQRNSKVFFKPL 435 *************************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (429 nodes) Target sequences: 1 (435 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 8.39 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory