Align Acetylornithine deacetylase; AO; Acetylornithinase; N-acetylornithinase; NAO; EC 3.5.1.16 (characterized)
to candidate GFF3373 HP15_3315 acetylornithine deacetylase (ArgE)
Query= SwissProt::P23908 (383 letters) >FitnessBrowser__Marino:GFF3373 Length = 389 Score = 372 bits (955), Expect = e-108 Identities = 189/378 (50%), Positives = 249/378 (65%), Gaps = 1/378 (0%) Query: 5 LPPFIEIYRALIATPSISATEEALDQSNADLITLLADWFKDLGFNVEVQPVPGTRNKFNM 64 +P ++ LI+ PSIS+ D SN ++ LA+W + LGF+VE+ VPG KFN+ Sbjct: 11 VPGIRDMLARLISLPSISSASAKWDHSNEPVVRTLAEWLEALGFSVEILEVPGMPGKFNL 70 Query: 65 LASIGQGAGGLLLAGHTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDAL 124 + ++G G GGL+L+GHTDTVPFDD RW DPFTLTE D + YGLGT DMKGFF ++A Sbjct: 71 IGTLGSGPGGLVLSGHTDTVPFDDKRWQSDPFTLTERDNRWYGLGTCDMKGFFPLAIEAA 130 Query: 125 RDVDVTKLKKPLYILATADEETSMAGARYFAETTALRPDCAIIGEPTSLQPVRAHKGHIS 184 R LK+PL ILATADEE+SM GAR AE + A+IGEPTSL+PVR HKG + Sbjct: 131 RAFVDEDLKQPLIILATADEESSMDGARALAEAGKPKARYAVIGEPTSLKPVRMHKGIMM 190 Query: 185 NAIRIQGQSGHSSDPARGVNAIELMHDAIGHILQLRDNLKERYHYEAFTVPYPTLNLGHI 244 ++ +GQSGHSS+PA G NA+E MH+A+ +L LR +E+Y F V +PTLNLG I Sbjct: 191 ERLKFEGQSGHSSNPALGRNAMEGMHEALTELLALRSGWQEKYRNPNFEVQFPTLNLGCI 250 Query: 245 HGGDASNRICACCELHMDIRPLPGMTLNELNGLLNDALAPVSERWPGRLTVDELHPPIPG 304 HGGD NRICA CELH D+RPLPGM + L + + P+++R L + L +P Sbjct: 251 HGGDNPNRICAQCELHFDLRPLPGMNMETLRQAILSKVQPIADRRELSLEFEPLFDGVPP 310 Query: 305 YECPPNHQLVEVVEKLLGAKTEVVNYCTEAPFIQTL-CPTLVLGPGSINQAHQPDEYLET 363 +E P + LV+ EKL G V + TEAP++Q L TLV+GPGSI+QAHQPDE++E Sbjct: 311 FETPADAALVKACEKLTGHTAHAVAFATEAPWLQKLGLETLVMGPGSIDQAHQPDEFIEL 370 Query: 364 RFIKPTRELITQVIHHFC 381 I PT +++ +I FC Sbjct: 371 SQIDPTVKVLRGLIRQFC 388 Lambda K H 0.320 0.139 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 440 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 389 Length adjustment: 30 Effective length of query: 353 Effective length of database: 359 Effective search space: 126727 Effective search space used: 126727 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate GFF3373 HP15_3315 (acetylornithine deacetylase (ArgE))
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.18259.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-126 407.9 0.0 2.3e-126 407.7 0.0 1.0 1 lcl|FitnessBrowser__Marino:GFF3373 HP15_3315 acetylornithine deacet Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF3373 HP15_3315 acetylornithine deacetylase (ArgE) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 407.7 0.0 2.3e-126 2.3e-126 1 364 [. 16 383 .. 16 384 .. 0.96 Alignments for each domain: == domain 1 score: 407.7 bits; conditional E-value: 2.3e-126 TIGR01892 1 eilakLvafdsvsar......snvdlieyvedyleelgvavevlpvadgaeksnllaviGpkegagglvlsGhtD 69 ++la+L++++s+s sn +++ ++++le+lg++ve l+v++ k+nl+ + G +g gglvlsGhtD lcl|FitnessBrowser__Marino:GFF3373 16 DMLARLISLPSISSAsakwdhSNEPVVRTLAEWLEALGFSVEILEVPGMPGKFNLIGTLG--SGPGGLVLSGHTD 88 57999*******998899999***************************************..999********** PP TIGR01892 70 vvPvdeaaWtsDpfrLtekdgrLYgrGtaDmkGFlalvLaavpdlaaakLkkPlhlvlsaDeevglaGakkliea 144 +vP+d+++W sDpf+Lte+d+r Yg+Gt+DmkGF+ l+++a++ ++Lk+Pl ++++aDee ++ Ga+ l+ea lcl|FitnessBrowser__Marino:GFF3373 89 TVPFDDKRWQSDPFTLTERDNRWYGLGTCDMKGFFPLAIEAARAFVDEDLKQPLIILATADEESSMDGARALAEA 163 *************************************************************************** PP TIGR01892 145 larrpalaivGePtslvavRahkGkasakvtvrGreghssrpdrGvsaielaakllarlvaladklkredleeaF 219 + ++++ a++GePtsl++vR hkG++ +++ +G++ghss+p+ G +a+e ++++l++l+al+ ++++ + F lcl|FitnessBrowser__Marino:GFF3373 164 GKPKARYAVIGEPTSLKPVRMHKGIMMERLKFEGQSGHSSNPALGRNAMEGMHEALTELLALRSGWQEKYRNPNF 238 *************************************************************************** PP TIGR01892 220 tppyatlniGtvkGGkavniiaaaCelvlelRpipGmdpeellallekiaeevkekapgfevkve.elsatpale 293 +++++tln+G ++GG+ n+i+a+Cel+++lRp+pGm++e l + + + +++ + + + e + p +e lcl|FitnessBrowser__Marino:GFF3373 239 EVQFPTLNLGCIHGGDNPNRICAQCELHFDLRPLPGMNMETLRQAILSKVQPIA-DRRELSLEFEpLFDGVPPFE 312 *********************************************999999984.4444445544167889**** PP TIGR01892 294 leedaelvalleklaGaaaevvsygteagllqelGieavvlGPGdidqahqpdeYveieelkrcrallerl 364 +++da lv+ ekl+G++a++v+++tea+ lq+lG+e++v+GPG+idqahqpde++e++++ ++ ++l+ l lcl|FitnessBrowser__Marino:GFF3373 313 TPADAALVKACEKLTGHTAHAVAFATEAPWLQKLGLETLVMGPGSIDQAHQPDEFIELSQIDPTVKVLRGL 383 ****************************************************************9998865 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (389 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.24 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory