Align δ1-pyrroline-5-carboxylate synthetase (EC 1.2.1.41; EC 2.7.2.11) (characterized)
to candidate GFF618 HP15_601 gamma-glutamyl phosphate reductase
Query= metacyc::AT2G39800-MONOMER (717 letters) >FitnessBrowser__Marino:GFF618 Length = 418 Score = 275 bits (702), Expect = 4e-78 Identities = 148/404 (36%), Positives = 240/404 (59%), Gaps = 7/404 (1%) Query: 302 ARESSRKLQALSSEDRKKILLDIADALEANVTTIKAENELDVASAQEAGLEESMVARLVM 361 AR ++ + ++ R + LL A+AL+A + N D+ +E GL+ +M+ RL + Sbjct: 14 ARAAATGVARSTTAVRNQALLATAEALDAAREELALANGKDLQMGRENGLDAAMLDRLEL 73 Query: 362 TPGKISSLAASVRKLADMEDPIGRVLKKTEVADGLVLEKTSSPLGVLLIVFESRPDALVQ 421 TP +I ++ +R++A + DPIG + G+ + K PLGV+ I++ESRP+ V+ Sbjct: 74 TPQRIDTMIEGLRQVASLPDPIGAITDMNYRPSGIQVGKMRVPLGVIGIIYESRPNVTVE 133 Query: 422 IASLAIRSGNGLLLKGGKEARRSNAILHKVITDAIPET---VGGKLIGLVTSREEIPDLL 478 ASL ++SGN +L+GG E+ SN + + ++ + + + T R + +L+ Sbjct: 134 AASLCLKSGNATILRGGSESIHSNQAIARCLSAGLAKAGLPENAVQVIKTTDRAAVGELI 193 Query: 479 KLDDVIDLVIPRGSNKLVTQIKNTTKIPVLGHADGICHVYVDKACDTDMAKRIVSDAKLD 538 + D +D+++PRG L+ +I ++PV+ H DG+CHVY+D D + A ++ +AK Sbjct: 194 TMPDYVDVIVPRGGKGLIERISRDARVPVIKHLDGVCHVYIDSHADPEKALKVAINAKTH 253 Query: 539 YPAACNAMETLLVHKDLEQNAVLNELIFALQSNGVTLYGGPRASKILN-IPEARS--FNH 595 CN METLLV ++ ++ +L L A GV L G R I+ + EA + Sbjct: 254 RYGTCNTMETLLVDAEIAED-ILPLLAQAFVEKGVELRGCERTRAIVEGVVEATEADWEA 312 Query: 596 EYCAKACTVEVVEDVYGAIDHIHRHGSAHTDCIVTEDHEVAELFLRQVDSAAVFHNASTR 655 EY A V VV+ + GAI HI+R+ S HTD I+TE++ A F+ +VDS++V NASTR Sbjct: 313 EYLAPVLAVRVVDGLEGAIAHINRYSSQHTDSIITENYTRARRFITEVDSSSVMVNASTR 372 Query: 656 FSDGFRFGLGAEVGVSTGRIHARGPVGVEGLLTTRWIMRGKGQV 699 F+DGF +GLGAE+G+ST +IHARGPVG+EGL + ++++ G G + Sbjct: 373 FADGFEYGLGAEIGISTDKIHARGPVGLEGLTSQKYVVFGDGHI 416 Lambda K H 0.318 0.135 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 602 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 717 Length of database: 418 Length adjustment: 36 Effective length of query: 681 Effective length of database: 382 Effective search space: 260142 Effective search space used: 260142 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory