Align prephenate dehydrogenase (EC 1.3.1.12); prephenate dehydratase (EC 4.2.1.51); Chorismate mutase (EC 5.4.99.5) (characterized)
to candidate GFF1395 HP15_1362 chorismate mutase / prephenate dehydratase
Query= BRENDA::O30012 (620 letters) >FitnessBrowser__Marino:GFF1395 Length = 365 Score = 158 bits (400), Expect = 3e-43 Identities = 105/337 (31%), Positives = 175/337 (51%), Gaps = 15/337 (4%) Query: 268 ELRGLIKSIDSLILRLIERRIDAARQIARIKMERGEPIELKDVEEEKLWEVMSKTT---- 323 ELR I +D I+ LI R A+++A +KM ++ E+ +V+ + Sbjct: 10 ELRDEIDQLDQKIMELISARAACAQEVAHVKMTANPGQDVFFYRPEREAQVLRRIKEQNP 69 Query: 324 --LNPVKLKEIFEGIMSLAKEEEYKVAGVKYTIAVLGPQGSFSEEMALKLVGSRVPLRYC 381 L+ ++ +F IMS E + IA LGP G+F++ ALK G V Sbjct: 70 GPLSGEEMARLFREIMSACLALEKPMH-----IAFLGPIGTFTQAAALKHFGHSVVSVPL 124 Query: 382 STTDEIIKLVESGEVDYGLVPIENSVNGTVLPVIDALLNHDVEVFGEAKLEVNHCLVAKR 441 D + + VESG YG+VP+ENS G + +D ++ +++ GE +L ++H L+ Sbjct: 125 PAIDAVFREVESGAAHYGVVPVENSTEGMINHTLDMFMSSPLKICGEVQLRIHHHLLVSP 184 Query: 442 KIELKEIKTIYSHPQAVAQCMGFINNYLPSVAIRYTTSTSDAARML--DDYSAAIMSENA 499 K +EI IYSH Q+ AQC +++ + + +S ++AAR + +AAI + A Sbjct: 185 KHGDQEITRIYSHQQSFAQCRQWLDTHRYGIERVTVSSNAEAARRAAEEPGTAAIAGDMA 244 Query: 500 ARFYRLHVLRKGIQDLKGRNITRFYLIRRRSGRSEG-KITSLFFGVEDKPGALKDVLEVF 558 A Y L L I+D + N TRF +I R + G +S+ + +KPGAL +LE F Sbjct: 245 AELYGLQKLANSIED-RPDNTTRFLIIGREEVPASGHDKSSILVSMRNKPGALYQLLEPF 303 Query: 559 HKKGFNLRKLESRPAGTGLGDYVFFVEVEAPLREEDL 595 H+ G +L ++E+RP+ +G YVF+++ E + +E + Sbjct: 304 HRHGLSLTRIETRPSPSGTWAYVFYIDFEGHMEDEQV 340 Lambda K H 0.320 0.137 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 466 Number of extensions: 30 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 620 Length of database: 365 Length adjustment: 33 Effective length of query: 587 Effective length of database: 332 Effective search space: 194884 Effective search space used: 194884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory