Align Aspartate/prephenate aminotransferase; AspAT / PAT; EC 2.6.1.1; EC 2.6.1.78 (characterized)
to candidate GFF3329 HP15_3271 aspartate aminotransferase
Query= SwissProt::Q8KDS8 (400 letters) >FitnessBrowser__Marino:GFF3329 Length = 431 Score = 155 bits (393), Expect = 2e-42 Identities = 115/388 (29%), Positives = 193/388 (49%), Gaps = 21/388 (5%) Query: 1 MSVESFERF-LSRRVLSMQESQTMKITGLAKKMQAEGKDVVSLSAGEPDFPTPENVCEAG 59 M +++ R+ ++ V +Q S T++I L+ +++EGKD++ L G+ FP P+ V EA Sbjct: 1 MDIQNDHRYAINLNVRGIQPSATLRINELSNHLKSEGKDIIKLGLGQSPFPVPDRVVEAL 60 Query: 60 IEAIRKGFTRYTANSGIPELKKAIIRKLQRDNGLEYAEDEIIVSNGGKQALANTFLALCD 119 E + Y G+ L++AI ++R + +++++ G K+ L L L Sbjct: 61 KEHAHE--KDYLPVKGLKGLREAIAGYIRRSERMHCTWEDVLIGPGSKELLF--MLQLAY 116 Query: 120 EGDEVIVPAPYWVSFPEMARLAEATPVIVETSIETGYKMTPEQLAAAITP---KTRILVL 176 GD +++P P WVS+ AR+ + + T E +++T E+L + RIL+L Sbjct: 117 YGD-LLIPRPSWVSYAPQARIIGRSVHWLPTHAENNWQLTAEELDIICRDDPSRPRILIL 175 Query: 177 NSPSNPSGAVYNEAEVRALMQVIEGKEIFVLSDEMYDMICYGGVRPFSPARIPEMKPWVI 236 N PSNP+G Y + ++ A+ V + +LSDE+Y + + G PE I Sbjct: 176 NYPSNPTGCTYTDDQLLAIANVARKYRLILLSDEIYGEVHFEGRHKSIARYYPE---GTI 232 Query: 237 VSNGTSKSYSMTGWRIGYLAAPKW---IINACDKIQSQTTSNANSIAQKAAVAALDGDQS 293 +S G SK GWR+G P+ + +A I S+T + ++ Q AA+AA +G Sbjct: 233 ISTGLSKWAGAGGWRLGTFIFPRELRPLQDAMAIIASETYTATSAPIQHAAIAAFNGGDD 292 Query: 294 I---VEQRRAEFEKRRDFMFRELNTISGIECTLPEGAFYIFPSIKGLLGKTFGGKVMKDS 350 I ++Q R + ++M R L+ + G PEGAFY+FP G + K +K S Sbjct: 293 IDEYLKQSRRVLKVVGEYMHRRLSDM-GAVVQKPEGAFYLFPDFSG-FREQLASKDIKTS 350 Query: 351 TDVAEYLLTEHYVATVPGDAFG-APENL 377 + LL VA +P FG P++L Sbjct: 351 QAFCQALLENTGVAILPASDFGFVPDHL 378 Lambda K H 0.316 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 385 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 431 Length adjustment: 31 Effective length of query: 369 Effective length of database: 400 Effective search space: 147600 Effective search space used: 147600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory