GapMind for Amino acid biosynthesis

 

Alignments for a candidate for argG in Desulfovibrio vulgaris Miyazaki F

Align Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 (characterized)
to candidate 8499268 DvMF_0047 argininosuccinate synthase (RefSeq)

Query= SwissProt::P59846
         (400 letters)



>FitnessBrowser__Miya:8499268
          Length = 401

 Score =  505 bits (1301), Expect = e-148
 Identities = 242/387 (62%), Positives = 296/387 (76%), Gaps = 1/387 (0%)

Query: 2   KIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQGEEVEEAREKALRTGASKAIALDL 61
           K+VLAYSGGLDTS+ILKW+  TY  EV+  TAD+GQ E+++    KALRTGAS+A   DL
Sbjct: 7   KVVLAYSGGLDTSVILKWIAVTYGCEVVTLTADLGQEEDLDGVDAKALRTGASRAYVEDL 66

Query: 62  KEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKGND 121
           +EEF RDF+FPMMR+GAVYEG YLLGTSIARPLIAK LV IA  EGA+A+AHGATGKGND
Sbjct: 67  REEFARDFIFPMMRSGAVYEGRYLLGTSIARPLIAKRLVDIARAEGAQAVAHGATGKGND 126

Query: 122 QVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQEKPYSMDANLLHI 181
           QVRFEL   AL PD+ VIAPWR W  + R ++ A+AE HGIP+  T  K YSMD N+LH 
Sbjct: 127 QVRFELAVNALAPDLDVIAPWRIWDLRSRTDLTAFAEQHGIPLS-TSSKQYSMDRNMLHC 185

Query: 182 SYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNGERLSPAALLQR 241
           S+EGG LEDPW EP      M    E+APD PEY+ +EF +GD VAVNGE +SPA++++ 
Sbjct: 186 SFEGGELEDPWCEPGPNSHVMAVPVEQAPDTPEYITIEFKKGDAVAVNGEAMSPASIIRT 245

Query: 242 LNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLHQRDML 301
           LN IGGRHG+GR+D+VENRFVG+KSRGVYETPGGT+L+ A R +E + +DRE +H RD L
Sbjct: 246 LNTIGGRHGIGRLDMVENRFVGIKSRGVYETPGGTVLHIAHRDLEGICMDRESMHLRDQL 305

Query: 302 SPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGRKAPKSLYRQD 361
            P+Y+E VY GFW+APEREA+QA+ D    +V G  RLKLYKGN Y VGR +P +LY  D
Sbjct: 306 IPRYSEAVYNGFWFAPEREAMQAFIDKTQETVNGTVRLKLYKGNAYPVGRTSPNTLYCHD 365

Query: 362 LVSFDEAGGYDQKDAEGFIKIQALRLR 388
           L +F++   YD  DA GFIK+Q LR+R
Sbjct: 366 LATFEDCATYDHADAAGFIKLQGLRVR 392


Lambda     K      H
   0.319    0.137    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 473
Number of extensions: 16
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 400
Length of database: 401
Length adjustment: 31
Effective length of query: 369
Effective length of database: 370
Effective search space:   136530
Effective search space used:   136530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

Align candidate 8499268 DvMF_0047 (argininosuccinate synthase (RefSeq))
to HMM TIGR00032 (argG: argininosuccinate synthase (EC 6.3.4.5))

Software error:

../bin/blast/fastacmd -i /tmp/list.3579.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.3579.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.