GapMind for Amino acid biosynthesis

 

Aligments for a candidate for argG in Desulfovibrio vulgaris Miyazaki F

Align Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 (characterized)
to candidate 8499268 DvMF_0047 argininosuccinate synthase (RefSeq)

Query= SwissProt::P59846
         (400 letters)



>lcl|FitnessBrowser__Miya:8499268 DvMF_0047 argininosuccinate
           synthase (RefSeq)
          Length = 401

 Score =  505 bits (1301), Expect = e-148
 Identities = 242/387 (62%), Positives = 296/387 (76%), Gaps = 1/387 (0%)

Query: 2   KIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQGEEVEEAREKALRTGASKAIALDL 61
           K+VLAYSGGLDTS+ILKW+  TY  EV+  TAD+GQ E+++    KALRTGAS+A   DL
Sbjct: 7   KVVLAYSGGLDTSVILKWIAVTYGCEVVTLTADLGQEEDLDGVDAKALRTGASRAYVEDL 66

Query: 62  KEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKGND 121
           +EEF RDF+FPMMR+GAVYEG YLLGTSIARPLIAK LV IA  EGA+A+AHGATGKGND
Sbjct: 67  REEFARDFIFPMMRSGAVYEGRYLLGTSIARPLIAKRLVDIARAEGAQAVAHGATGKGND 126

Query: 122 QVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQEKPYSMDANLLHI 181
           QVRFEL   AL PD+ VIAPWR W  + R ++ A+AE HGIP+  T  K YSMD N+LH 
Sbjct: 127 QVRFELAVNALAPDLDVIAPWRIWDLRSRTDLTAFAEQHGIPLS-TSSKQYSMDRNMLHC 185

Query: 182 SYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNGERLSPAALLQR 241
           S+EGG LEDPW EP      M    E+APD PEY+ +EF +GD VAVNGE +SPA++++ 
Sbjct: 186 SFEGGELEDPWCEPGPNSHVMAVPVEQAPDTPEYITIEFKKGDAVAVNGEAMSPASIIRT 245

Query: 242 LNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLHQRDML 301
           LN IGGRHG+GR+D+VENRFVG+KSRGVYETPGGT+L+ A R +E + +DRE +H RD L
Sbjct: 246 LNTIGGRHGIGRLDMVENRFVGIKSRGVYETPGGTVLHIAHRDLEGICMDRESMHLRDQL 305

Query: 302 SPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGRKAPKSLYRQD 361
            P+Y+E VY GFW+APEREA+QA+ D    +V G  RLKLYKGN Y VGR +P +LY  D
Sbjct: 306 IPRYSEAVYNGFWFAPEREAMQAFIDKTQETVNGTVRLKLYKGNAYPVGRTSPNTLYCHD 365

Query: 362 LVSFDEAGGYDQKDAEGFIKIQALRLR 388
           L +F++   YD  DA GFIK+Q LR+R
Sbjct: 366 LATFEDCATYDHADAAGFIKLQGLRVR 392


Lambda     K      H
   0.319    0.137    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 473
Number of extensions: 16
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 400
Length of database: 401
Length adjustment: 31
Effective length of query: 369
Effective length of database: 370
Effective search space:   136530
Effective search space used:   136530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

Align candidate 8499268 DvMF_0047 (argininosuccinate synthase (RefSeq))
to HMM TIGR00032 (argG: argininosuccinate synthase (EC 6.3.4.5))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00032.hmm
# target sequence database:        /tmp/gapView.4563.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00032  [M=394]
Accession:   TIGR00032
Description: argG: argininosuccinate synthase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
   8.9e-152  491.9   0.0     1e-151  491.6   0.0    1.0  1  lcl|FitnessBrowser__Miya:8499268  DvMF_0047 argininosuccinate synt


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Miya:8499268  DvMF_0047 argininosuccinate synthase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  491.6   0.0    1e-151    1e-151       1     393 [.       7     398 ..       7     399 .. 0.99

  Alignments for each domain:
  == domain 1  score: 491.6 bits;  conditional E-value: 1e-151
                         TIGR00032   1 kvvlaysGGlDtsvalklleek.gaeviavtvdvGqpeedldaieekalklGaekayviDareefvkdylfaaiqan 76 
                                       kvvlaysGGlDtsv+lk++    g+ev+++t+d+Gq eedld ++ kal+ Ga +ayv D reef++d++f+ ++ +
  lcl|FitnessBrowser__Miya:8499268   7 KVVLAYSGGLDTSVILKWIAVTyGCEVVTLTADLGQ-EEDLDGVDAKALRTGASRAYVEDLREEFARDFIFPMMRSG 82 
                                       8*******************999*************.8*************************************** PP

                         TIGR00032  77 avyegkYllstaLaRpliakklvevakkegaeavahGctgKGnDqvRFelsilllnpdlkviaPvreleli.Reeei 152
                                       avyeg+Yll+t++aRpliak+lv++a+ ega+avahG+tgKGnDqvRFel + +l+pdl+viaP+r ++l  R+++ 
  lcl|FitnessBrowser__Miya:8499268  83 AVYEGRYLLGTSIARPLIAKRLVDIARAEGAQAVAHGATGKGNDQVRFELAVNALAPDLDVIAPWRIWDLRsRTDLT 159
                                       **********************************************************************88***** PP

                         TIGR00032 153 eyaaekGievpvekekaysiDenllgrsiEageLEdpsteppediyelvkdpiektedepevveieFekGvPvalng 229
                                       ++a+++Gi++ ++ +k+ys+D+n+l+ s E+geLEdp+ ep  + + + + p+e+ +d+pe+++ieF+kG  va+ng
  lcl|FitnessBrowser__Miya:8499268 160 AFAEQHGIPLSTS-SKQYSMDRNMLHCSFEGGELEDPWCEPGPNSHVMAV-PVEQAPDTPEYITIEFKKGDAVAVNG 234
                                       **********998.6**************************999998888.99************************ PP

                         TIGR00032 230 eslepvelilkaneiagkhGvGriDivEdRiiglKsReiYEapalllLikAhkdLetlvltkdvlefkeiveekyse 306
                                       e ++p  +i+++n i+g+hG+Gr+D+vE+R +g+KsR++YE+p+ ++L++Ah+dLe   ++++ +++++    +yse
  lcl|FitnessBrowser__Miya:8499268 235 EAMSPASIIRTLNTIGGRHGIGRLDMVENRFVGIKSRGVYETPGGTVLHIAHRDLEGICMDRESMHLRDQLIPRYSE 311
                                       ***************************************************************************** PP

                         TIGR00032 307 liYkGlwfdplaealdalikktqervtGtvrvklfkGnaivigrkseyslYdeelvsfekdkefdqkdaiGfikirg 383
                                        +Y+G+wf p++ea++a+i+ktqe v+Gtvr+kl+kGna+ +gr+s+++lY ++l++fe  +++d+ da+Gfik++g
  lcl|FitnessBrowser__Miya:8499268 312 AVYNGFWFAPEREAMQAFIDKTQETVNGTVRLKLYKGNAYPVGRTSPNTLYCHDLATFEDCATYDHADAAGFIKLQG 388
                                       ***************************************************************************** PP

                         TIGR00032 384 lqikvyrekl 393
                                       l+++ y++++
  lcl|FitnessBrowser__Miya:8499268 389 LRVRGYAQRV 398
                                       ****999876 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (394 nodes)
Target sequences:                          1  (401 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 8.76
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory