Align Putative [LysW]-aminoadipate/[LysW]-glutamate kinase; EC 2.7.2.17; EC 2.7.2.19 (uncharacterized)
to candidate 8499536 DvMF_0306 acetylglutamate kinase (RefSeq)
Query= curated2:A9A1K7 (267 letters) >FitnessBrowser__Miya:8499536 Length = 320 Score = 128 bits (321), Expect = 2e-34 Identities = 84/259 (32%), Positives = 141/259 (54%), Gaps = 16/259 (6%) Query: 2 ITIKIGGSVVDD-----LHPSTIADIKKIAESEGVILVHGGGKEVTKVCEQLGKEPKFVT 56 + IK GG + D IA +K++ + ++VHGGG ++ ++ EQL + +F Sbjct: 40 VVIKYGGHAMKDEALKKAFALNIALLKQVGINP--VVVHGGGPQIGRMLEQLHIQSQF-- 95 Query: 57 SPSGIKSRYTDKETAEIFTMVMSGRINKTIVQMLQKNGINAIGLSGVDAKVIEADRKKKL 116 G+ R TD T ++ MV+ G++NK IV +L +G+ A+GLSG D ++I A RK ++ Sbjct: 96 -REGL--RVTDDATMDVVEMVLVGKVNKEIVNLLNLSGVKAVGLSGKDGQLIRA-RKMEM 151 Query: 117 LIVNEKGRKQAIDGGYTGKIREVNASFIKSLLDQGLTPVISPIAISEESEFLNVDGDRAA 176 ++ + ID G G++ V + ++SL PVI+P+ + E E N++ D A Sbjct: 152 IVNGGNHAPEIIDLGKVGEVMRVETTLLRSLERDNFVPVIAPVGVDENGETYNINADAVA 211 Query: 177 AYVAGKVGSDKVLFITNVDGLLMDDK-VVPKLTLAEAKEI--RPKIGPGMEKKILASTEA 233 VA + + ++L +T+V G+L K ++ LT EA E+ + GM K+ EA Sbjct: 212 GAVAAALRAKRLLLLTDVAGILDKQKELIRSLTTREAVELFTDGTLTGGMIPKVKCCLEA 271 Query: 234 LDMGVTTALIANGQKENPI 252 L+ GV A+I +G+ EN I Sbjct: 272 LEEGVEKAMIVDGRVENCI 290 Lambda K H 0.313 0.133 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 320 Length adjustment: 26 Effective length of query: 241 Effective length of database: 294 Effective search space: 70854 Effective search space used: 70854 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory