GapMind for Amino acid biosynthesis

 

Aligments for a candidate for cimA in Desulfovibrio vulgaris Miyazaki F

Align (R)-citramalate synthase CimA; EC 2.3.1.182 (characterized)
to candidate 8501055 DvMF_1791 2-isopropylmalate synthase (RefSeq)

Query= SwissProt::Q58787
         (491 letters)



>lcl|FitnessBrowser__Miya:8501055 DvMF_1791 2-isopropylmalate
           synthase (RefSeq)
          Length = 514

 Score =  375 bits (963), Expect = e-108
 Identities = 218/500 (43%), Positives = 308/500 (61%), Gaps = 18/500 (3%)

Query: 3   VRIFDTTLRDGEQTPGVSLTPNDKLEIAKKLDELGVDVIEAGSAITSKGEREGIKLITKE 62
           +RIFDTTLRDGEQ+PG ++   +K+ +A++L+ LGVD++EAG   +S+G+ E ++ I + 
Sbjct: 8   IRIFDTTLRDGEQSPGATMNLQEKIRLARQLETLGVDIMEAGFPASSQGDFEAVQAIARA 67

Query: 63  GLNAEICSFVRALPVDIDAALE----CDVDSVHLVVPTSPIHMKYKLRKTEDEVLETALK 118
               E+    RA+P DID A E     +   +H  + TSP+HM+YKLRK  D+V+E A+ 
Sbjct: 68  VKGVEVAGLCRAMPADIDRAWEAVKVAENPRIHTFLATSPVHMQYKLRKEPDQVVEMAVA 127

Query: 119 AVEYAKEHGLIVELSAEDATRSDVNFLIKLFNEGEKVGADRVCVCDTVGVLTPQKSQELF 178
           AV +A ++   VE SAEDA+RS+ +FL+++F      GA  + V DTVG   P++   L 
Sbjct: 128 AVRHAAKYTSNVEFSAEDASRSNPDFLVRVFEAVINAGATTINVPDTVGYAQPEEFGRLI 187

Query: 179 KKITENV----NLPVSVHCHNDFGMATANTCSAVLGGAVQCHVTVNGIGERAGNASLEEV 234
           + + EN         SVHCHND GM  ANT +A+  GA Q  VT++GIGERAGNASLEE+
Sbjct: 188 RYVIENTPNSHKAVFSVHCHNDLGMGVANTLAALKAGARQAEVTISGIGERAGNASLEEI 247

Query: 235 VAAL---KILYGYDTKIKMEKLYEVSRIVSRLMKLPVPPNKAIVGDNAFAHEAGIHVDGL 291
           V AL   +  Y  D  +  E+L+   R++S ++  P+PPNKAIVG NAFAHE+GIH DG+
Sbjct: 248 VMALHTRRDFYQLDCGVVTEQLFPTCRLLSMIIGQPIPPNKAIVGANAFAHESGIHQDGM 307

Query: 292 IKNTETYEPIKPEMVGNRRR-IILGKHSGRKALKYKLDLMGINVSDEQLNKIYERVKEFG 350
           +KN ETYE + PE +G  +  +++GKHSGR A+K KLD +G  + + QL  ++E VK+  
Sbjct: 308 LKNRETYEIMTPESIGKTKTDLVIGKHSGRNAVKNKLDELGYRLEEAQLVTVFEAVKKLA 367

Query: 351 DLGKYISDADLLAIVREVTGKLVEEKIKLDELTV-VSGNKITPIASVKLHYKGEDITLIE 409
           D  K I D D+ A+V E   +L  +  +L  L+V  S   + P A+V +   GE      
Sbjct: 368 DKKKQIYDEDIEALVLEEVYRL-PDLYRLVNLSVQCSDTGMPPTAAVVMDVMGE--VKRA 424

Query: 410 TAYGVGPVDAAINAVRKAISGVADIKLVEYRVEAIGGGTDALIEVVVKLRKGTEIVEVRK 469
             +GVGP+DA  N + + I G A + L  Y V AI GGTDA  EV V+LR+       R 
Sbjct: 425 AGFGVGPIDAVFNVIGE-IVGRAPV-LERYSVTAITGGTDAQGEVTVRLRQNGSSAVGRG 482

Query: 470 SDADIIRASVDAVMEGINML 489
           SD DII AS  A +  +N L
Sbjct: 483 SDPDIILASARAYVNALNRL 502


Lambda     K      H
   0.316    0.136    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 601
Number of extensions: 29
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 491
Length of database: 514
Length adjustment: 34
Effective length of query: 457
Effective length of database: 480
Effective search space:   219360
Effective search space used:   219360
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory