Align acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17] (characterized)
to candidate 8500245 DvMF_1002 adenosylmethionine-8-amino-7-oxononanoate aminotransferase (RefSeq)
Query= reanno::azobra:AZOBR_RS19025 (389 letters) >FitnessBrowser__Miya:8500245 Length = 491 Score = 164 bits (416), Expect = 4e-45 Identities = 138/415 (33%), Positives = 198/415 (47%), Gaps = 59/415 (14%) Query: 14 IVFERGEGPYLYATDGRRFLDFAAGVAVNVLGHANPYLVEALTAQAHKLWHTSNLFRVAG 73 +V EG L TDG +LD + + NV GH +P L A+ AQ K+ HT+ L + Sbjct: 51 LVIGAAEGNRLTDTDGVSYLDGVSSLWTNVHGHRHPRLDAAIRAQLDKVAHTT-LLGLGS 109 Query: 74 QESLAKRLTEATFADT----VFFTNSGAEAWECGAKLIRKYHYEK-----GDKARTRIIT 124 + S+ A A VF+++SG+ + E K+ ++H + GD RTR ++ Sbjct: 110 EPSIELAARLAAIAPQGLTRVFYSDSGSTSVEVALKIAFQFHRQAPAHLGGDARRTRFLS 169 Query: 125 FEQAFHGRTLAAVSAAQQEKLIKGFGPLLDGFDLV----------PFG------DLEAVR 168 A+HG T+ AV+ + PLL FD V PFG + E + Sbjct: 170 LRNAYHGDTVGAVALGGMALFHSIYAPLL--FDTVKAESPYCYRCPFGRQAGSCERECIT 227 Query: 169 NAVT------DETAGICLEP-IQGEGGIRAGSVEFLRGLREICDEHGLLLFLDEIQCGMG 221 + T E +EP +QG G+ +LR +RE+CDEHG+ L DE+ G G Sbjct: 228 HMETLFARHGHELCAAVVEPLVQGAAGMLLQPPGWLRRVRELCDEHGVFLVADEVAVGFG 287 Query: 222 RTGKLFAHEWAGITPDVMAVAKGIGGGF-PLGACLATEKAASGMTAG-------THGSTY 273 +TG LFA E G+TPD + +AKGI GG+ PL A L TE+ G A HG TY Sbjct: 288 KTGTLFACEQEGVTPDFLCLAKGISGGYLPLAATLTTERVHDGFLARHEELRTFFHGHTY 347 Query: 274 GGNPLATAVGNAVLDKVLEPGFLDHVQRIGGLLQDRLAGLVAENPAVFKGVRGKGLMLGL 333 GNPLA A A LD E ++ +Q L RL L + P V +R +G+M G+ Sbjct: 348 TGNPLACAAAIASLDVFEEERVMERLQPKIARLAARLDTL-RDLPHV-GDIRQRGVMTGI 405 Query: 334 A------------CGPAVGD-VVVALRANGLLSVPAGDNVVRLLPPLNIGEAEVE 375 VG V + R G++ P GD V+ L+PPL+I + E++ Sbjct: 406 EMVRNRATKEAYDLALRVGHRVTLEARRRGVIIRPLGD-VMVLMPPLSITDDEID 459 Lambda K H 0.321 0.139 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 513 Number of extensions: 38 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 491 Length adjustment: 32 Effective length of query: 357 Effective length of database: 459 Effective search space: 163863 Effective search space used: 163863 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory