Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; EC 2.3.1.117; Tetrahydrodipicolinate N-succinyltransferase; THDP succinyltransferase; THP succinyltransferase; Tetrahydropicolinate succinylase (uncharacterized)
to candidate 8499909 DvMF_0674 hypothetical protein (RefSeq)
Query= curated2:Q6AA30 (320 letters) >FitnessBrowser__Miya:8499909 Length = 194 Score = 38.1 bits (87), Expect = 2e-07 Identities = 28/89 (31%), Positives = 36/89 (40%), Gaps = 1/89 (1%) Query: 179 VGTTVMHEGFVNFNAGTLGHSMVEGRISQGVIVGDGTDIGGGASIMGTLSGGGKERVTIG 238 +G V + N +G + G V G T + L GG E V IG Sbjct: 79 IGRNVYIGAYCNIGHADIGDDSLLGTHVM-VTSGKHTHFFDDPDVPIRLQGGRDECVRIG 137 Query: 239 RGCLLGAEAGIGISLGDNCVVEAGLYVTA 267 R C +G A + +GD CVV AG V A Sbjct: 138 RDCWIGNGAIVMADVGDGCVVAAGSVVAA 166 Lambda K H 0.318 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 194 Length adjustment: 24 Effective length of query: 296 Effective length of database: 170 Effective search space: 50320 Effective search space used: 50320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory