GapMind for Amino acid biosynthesis

 

Alignments for a candidate for dapH in Desulfovibrio vulgaris Miyazaki F

Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase; EC 2.3.1.89; Tetrahydrodipicolinate N-acetyltransferase; THP acetyltransferase; Tetrahydropicolinate acetylase (uncharacterized)
to candidate 8501167 DvMF_1901 transferase hexapeptide repeat containing protein (RefSeq)

Query= curated2:A8F8L8
         (238 letters)



>FitnessBrowser__Miya:8501167
          Length = 212

 Score = 30.8 bits (68), Expect = 2e-05
 Identities = 34/103 (33%), Positives = 41/103 (39%), Gaps = 19/103 (18%)

Query: 77  ARNSALPMADITKFNARV---EPGAVIR--DLVKIGDGAVIMMG---------AIINVGA 122
           AR  AL MA+    N  V     G  IR    V +G G VI             I+  G 
Sbjct: 83  ARTGALEMAENAALNVNVVVDADGGHIRMGAHVTVGPGTVIRAANHNFDRTDVPIMFQGH 142

Query: 123 VIGEKTMID-----MNAVIGGRAIIGRNCHIGAGAVIAGVIEP 160
             GE T+ D      N  I     IGR   +GAGAV+   +EP
Sbjct: 143 EYGEVTIEDDVWIAANCTITPGVHIGRGAVVGAGAVVTKDVEP 185


Lambda     K      H
   0.319    0.138    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 143
Number of extensions: 14
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 238
Length of database: 212
Length adjustment: 22
Effective length of query: 216
Effective length of database: 190
Effective search space:    41040
Effective search space used:    41040
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 46 (22.3 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory