GapMind for Amino acid biosynthesis

 

Aligments for a candidate for hcs in Desulfovibrio vulgaris Miyazaki F

Align homocitrate synthase (EC 2.3.3.14) (characterized)
to candidate 8501055 DvMF_1791 2-isopropylmalate synthase (RefSeq)

Query= BRENDA::D0VY45
         (540 letters)



>lcl|FitnessBrowser__Miya:8501055 DvMF_1791 2-isopropylmalate
           synthase (RefSeq)
          Length = 514

 Score =  435 bits (1119), Expect = e-126
 Identities = 234/514 (45%), Positives = 325/514 (63%), Gaps = 17/514 (3%)

Query: 25  VRILDTTLRDGEQSPGAAMTCVQKLETARQLAKLGVDIIEAGFPCASKQDFMAVKMIAEE 84
           +RI DTTLRDGEQSPGA M   +K+  ARQL  LGVDI+EAGFP +S+ DF AV+ IA  
Sbjct: 8   IRIFDTTLRDGEQSPGATMNLQEKIRLARQLETLGVDIMEAGFPASSQGDFEAVQAIARA 67

Query: 85  VGNCVDGNGYVPVITGVSRCNEKDIATAWEALKHAKRPRLRTFIATSPIHMEYKLRKSKD 144
           V            + G+ R    DI  AWEA+K A+ PR+ TF+ATSP+HM+YKLRK  D
Sbjct: 68  VKGVE--------VAGLCRAMPADIDRAWEAVKVAENPRIHTFLATSPVHMQYKLRKEPD 119

Query: 145 QVLETARNMVKFARSLGCTDIQFGAEDAARSDKEFLYQIFGEVIKAGATTLTIPDTVGIA 204
           QV+E A   V+ A     ++++F AEDA+RS+ +FL ++F  VI AGATT+ +PDTVG A
Sbjct: 120 QVVEMAVAAVRHAAKY-TSNVEFSAEDASRSNPDFLVRVFEAVINAGATTINVPDTVGYA 178

Query: 205 MPFEYGKLIADIKANTPGIENAIMATHCHNDLGLATANTIEGARYGARQLEVTINGIGER 264
            P E+G+LI  +  NTP    A+ + HCHNDLG+  ANT+   + GARQ EVTI+GIGER
Sbjct: 179 QPEEFGRLIRYVIENTPNSHKAVFSVHCHNDLGMGVANTLAALKAGARQAEVTISGIGER 238

Query: 265 AGNASFEEVVMALTCRGIDILGGLHTGINTRHILKTSKMVEKYSGLHLQPHKALVGANAF 324
           AGNAS EE+VMAL  R       L  G+ T  +  T +++    G  + P+KA+VGANAF
Sbjct: 239 AGNASLEEIVMALHTR--RDFYQLDCGVVTEQLFPTCRLLSMIIGQPIPPNKAIVGANAF 296

Query: 325 LHESGIHQDGMLKHRGTYEIISPEDIGLVRSVGDTIVLGKLSGRQALRNRLEELGYKLKD 384
            HESGIHQDGMLK+R TYEI++PE IG  ++    +V+GK SGR A++N+L+ELGY+L++
Sbjct: 297 AHESGIHQDGMLKNRETYEIMTPESIGKTKT---DLVIGKHSGRNAVKNKLDELGYRLEE 353

Query: 385 TEVEGVFWQFKAVAEKKKRITDTDLRALVSNEAFNEQPIWKLGDLQVTCGTVGFSTATVK 444
            ++  VF   K +A+KKK+I D D+ ALV  E +    +++L +L V C   G       
Sbjct: 354 AQLVTVFEAVKKLADKKKQIYDEDIEALVLEEVYRLPDLYRLVNLSVQCSDTGMPPTAAV 413

Query: 445 LFSIDGSMHVACSIGTGPVDSAYKAINHIVKEPAKLVKYTLGAITEGIDATATTSVEISR 504
           +  + G +  A   G GP+D+ +  I  IV     L +Y++ AIT G DA    +V + +
Sbjct: 414 VMDVMGEVKRAAGFGVGPIDAVFNVIGEIVGRAPVLERYSVTAITGGTDAQGEVTVRLRQ 473

Query: 505 GDTNHPVFSGTGGGTDVVVSSVDAYLSALNNMLR 538
              N     G G   D++++S  AY++ALN + +
Sbjct: 474 ---NGSSAVGRGSDPDIILASARAYVNALNRLAK 504


Lambda     K      H
   0.318    0.134    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 622
Number of extensions: 31
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 540
Length of database: 514
Length adjustment: 35
Effective length of query: 505
Effective length of database: 479
Effective search space:   241895
Effective search space used:   241895
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory