Align [amino group carrier protein]-C-terminal-L-glutamyl-γ-L-lysine aminotransferase (EC 2.6.1.118; EC 2.6.1.124) (characterized)
to candidate 8501786 DvMF_2502 glutamate-1-semialdehyde aminotransferase (RefSeq)
Query= metacyc::MONOMER-18314 (387 letters) >FitnessBrowser__Miya:8501786 Length = 425 Score = 124 bits (310), Expect = 7e-33 Identities = 86/301 (28%), Positives = 139/301 (46%), Gaps = 40/301 (13%) Query: 12 LTIVKGEAQYVWDIEGRRYLDFHTGIGVAFLGHRNPIILEYLKNQLENISILSTSFSTPI 71 L + + ++ ++G ++D+ G LGH +P++ + ++ TS+ P Sbjct: 35 LFVAHAKGSHLTTVDGTSFVDYVQSWGPMLLGHAHPVVASAIHAAVDR----GTSYGAPC 90 Query: 72 KDEMLQA---LDKVKPDKMDNAMLLNSGTEAVEAALKTARKITGRKKIIAFKNAFHGR-- 126 +DE++ A +D + +M ++NSGTEA +AL+ AR +TGR K++ F +HG Sbjct: 91 EDEVVLAEAVIDALPGVEM--VRMVNSGTEATMSALRLARGVTGRNKVVKFVGCYHGHAD 148 Query: 127 -----------------TAGSLSVTWNKKYREPFEPLVGPVEFLTFNNIEDLSKIDNETA 169 T G T P+ L E T + + A Sbjct: 149 AFLASAGSGVATLSIPGTPGVPEATVRDTLLAPYNDLTAVAELFTLHG--------KDIA 200 Query: 170 AVIVEPIQGESGVIPANIEFMKALKEKTENTGSLLIFDEIQTGFGRTGKLWAYKHYNIVP 229 A+IVEP+ G G++ F++ L++ G+LLIFDE+ TGF R A K ++I P Sbjct: 201 AIIVEPVAGNMGLVLPMNGFLQGLRDLCTEHGALLIFDEVITGF-RVNYGGAQKRFDITP 259 Query: 230 DILTAGKAIGGGFPVSVVFLPDHIANKLE---EGDHGSTYGGNPMAMAAVTAACKVIEKE 286 D+ T GK IGGG PV + ++ E T GNP+AMAA A ++K Sbjct: 260 DLTTLGKIIGGGLPVGAYGGRADLMRRIAPCGEVYQAGTLSGNPLAMAAGIATLAELKKS 319 Query: 287 N 287 + Sbjct: 320 D 320 Lambda K H 0.317 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 309 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 425 Length adjustment: 31 Effective length of query: 356 Effective length of database: 394 Effective search space: 140264 Effective search space used: 140264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory