Align Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 (characterized)
to candidate 8500823 DvMF_1564 aminotransferase class I and II (RefSeq)
Query= SwissProt::P96847 (388 letters) >FitnessBrowser__Miya:8500823 Length = 400 Score = 143 bits (360), Expect = 1e-38 Identities = 110/365 (30%), Positives = 165/365 (45%), Gaps = 13/365 (3%) Query: 31 GDLVNLSAGQPSAGAPEPVRAAAAAALHLNQLG--YSVALGIPELRDAIAADYQRRHGIT 88 G V+L G PS P+ + A AL + YS+ G+P LR+AIAAD R G Sbjct: 36 GGCVSLGQGVPSFRTPDHIVEAVCRALRDDPTAGRYSLQPGMPALREAIAADILARKGAR 95 Query: 89 VEPDAVV-ITTGSSGGFLLAFLACFDAGDRVAMASPGYPCY-RNILSALGCEVVEIPCGP 146 +P+ + +T G+ ++ L + GD V + SPGY + +L A G V +P Sbjct: 96 FDPETEIGVTVGAMEALVMIMLTVVERGDEVIIPSPGYASHAEQVLMAEGVPV-HVPLRA 154 Query: 147 QTRFQPTAQMLAEIDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYH 206 + + P R ++V SP NPTG V ++ A+ D+ LI D+ Y Sbjct: 155 ADWGLDVEAVRFAVTPRTRAIIVCSPGNPTGGVYDDADVRALCDLALERDLVLIVDDTYD 214 Query: 207 GLVY---QGAPQTSCAWQTS--RNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTG 261 +VY G P+ S Q R+ + VNSFSK YA+TGWR+G++ + + Sbjct: 215 YMVYGEQPGTPRFSPVSQPELRRHVITVNSFSKKYALTGWRVGYVAADAAWMAELLKVHD 274 Query: 262 NFTICPPVLSQIAAVSAFTPEATAEADGNLASYAINRSLLLDGLRRIGID-RLAPTDGAF 320 +C P +SQ AA++A T D A+ R L L + P GAF Sbjct: 275 ATAVCAPTVSQHAALAALTGPQDC-VDVMRAALTARRDLTCRRLDALAPHFAYVPPRGAF 333 Query: 321 YVYADVSDFTSDSLAFCSKLLADTGVAIAPGIDFDTARGGSFVRISFAGPSGDIEEALRR 380 Y A + +DS+ ++L + V PG F G +R+SF ++ EA R Sbjct: 334 YAMARYTFTDADSMTVARRMLEEARVITVPGGSFGPT-GERHLRLSFGMDEAELTEAFDR 392 Query: 381 IGSWL 385 I W+ Sbjct: 393 IQHWV 397 Lambda K H 0.321 0.136 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 451 Number of extensions: 27 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 400 Length adjustment: 31 Effective length of query: 357 Effective length of database: 369 Effective search space: 131733 Effective search space used: 131733 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory