GapMind for Amino acid biosynthesis

 

Alignments for a candidate for ilvH in Desulfovibrio vulgaris Miyazaki F

Align acetohydroxyacid synthase subunit B (EC 2.2.1.6) (characterized)
to candidate 8499376 DvMF_0153 acetolactate synthase, large subunit, biosynthetic type (RefSeq)

Query= metacyc::MONOMER-18810
         (585 letters)



>FitnessBrowser__Miya:8499376
          Length = 562

 Score =  605 bits (1559), Expect = e-177
 Identities = 313/565 (55%), Positives = 402/565 (71%), Gaps = 7/565 (1%)

Query: 18  EMIGAEILVHALAEEGVEYVWGYPGGAVLYIYDELHKQTKFEHILVRHEQAAVHAADGYA 77
           E+ GA IL+  L  EGV+ ++GYPGGAV+ IYDEL +     HILVRHEQAAVHAADG+A
Sbjct: 2   ELNGARILLECLKREGVDVLFGYPGGAVIDIYDELPRHD-IRHILVRHEQAAVHAADGFA 60

Query: 78  RATGKVGVALVTSGPGVTNAVTGIATAYLDSIPMVVITGNVPTHAIGQDAFQECDTVGIT 137
           RA+GKVGV LVTSGPG TN VTGIATAY DSIPMVV+TG VPT  IG DAFQE D VGIT
Sbjct: 61  RASGKVGVCLVTSGPGATNTVTGIATAYADSIPMVVLTGQVPTPLIGNDAFQEVDIVGIT 120

Query: 138 RPIVKHNFLVKDVRDLAATIKKAFFIAATGRPGPVVVDIPKDVSRNACKYEYPKSIDMRS 197
           RP  KHN+LVKDVRDLA  +++AF++A +GRPGPV+VD+PKDV +   ++ +P+ + +RS
Sbjct: 121 RPCTKHNYLVKDVRDLARVLRQAFYLARSGRPGPVLVDLPKDVMQAKTEFVWPEDVKLRS 180

Query: 198 YNPVNKGHSGQIRKAVALLQGAERPYIYTGGGVVLANASDELRQLAALTGHPVTNTLMGL 257
           YNP  + +  Q+R+AV  L  A+RP  + GGGV++++AS+EL  LA     PVT+TLMGL
Sbjct: 181 YNPTYRPNLNQLRRAVEALIEAKRPLFFAGGGVIMSDASEELGWLARTLSIPVTSTLMGL 240

Query: 258 GAFPGTSKQFVGMLGMHGTYEANMAMQNCDVLIAIGARFDDRVIGNPAHFTSQARKIIHI 317
           GAFPG    ++GM+GMHGTY  N A+ N D ++A+GARFDDRV G  + F S AR IIHI
Sbjct: 241 GAFPGDDPLWLGMIGMHGTYAGNKAVNNADCIVAVGARFDDRVTGRLSAFASGAR-IIHI 299

Query: 318 DIDPSSISKRVKVDIPIVGNVKDVLQELIAQIKASDIKPKREALA--KWWEQIEQWRSVD 375
           DIDP+SI K V+VDIP+VG+ +  L   I +I  + +  K  A A   W  Q+  WR+  
Sbjct: 300 DIDPTSIRKNVQVDIPVVGDCRKALAG-IREIATTRLAEKDWATAHEPWLTQVSAWRTEQ 358

Query: 376 CLKYDRSSEIIKPQYVVEKIWELTKGDAFICSDVGQHQMWAAQFYKFDEPRRWINSGGLG 435
            L Y ++   IKPQ VVE I+ +T+GDA + ++VGQ+QMW AQF+ F +PR  + SGGLG
Sbjct: 359 PLTYVKNGS-IKPQQVVETIFSITRGDAIVTTEVGQNQMWTAQFFTFRKPRTLLTSGGLG 417

Query: 436 TMGVGLPYAMGIKKAFPEKEVVTITGEGSIQMCIQELSTCLQYDTPVKICSLNNGYLGMV 495
           TMG G P A+G + AFP+K V+ + G+GSIQM IQEL+T +    P+KI  LNNGYLGMV
Sbjct: 418 TMGYGFPAAIGAQFAFPDKLVIDMAGDGSIQMNIQELATAVCNKLPIKIVILNNGYLGMV 477

Query: 496 RQWQEIEYDNRYSHSYMDALPDFVKLAEAYGHVGMRVEKTSDVEPALREAFRLKDRTVFL 555
           RQWQE+ Y   Y  + M+A PDFVKLAEAYG  G R+ +  ++E  LR AF     T  +
Sbjct: 478 RQWQELFYQRNYCSTCMEAQPDFVKLAEAYGAEGYRITEAGELESTLRAAF-ASPHTAVI 536

Query: 556 DFQTDPTENVWPMVQAGKGISEMLL 580
           D + +  ENV+PMV AG  + EMLL
Sbjct: 537 DVRVEREENVYPMVPAGAALDEMLL 561


Lambda     K      H
   0.319    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 866
Number of extensions: 33
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 585
Length of database: 562
Length adjustment: 36
Effective length of query: 549
Effective length of database: 526
Effective search space:   288774
Effective search space used:   288774
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)

Align candidate 8499376 DvMF_0153 (acetolactate synthase, large subunit, biosynthetic type (RefSeq))
to HMM TIGR00118 (ilvB: acetolactate synthase, large subunit, biosynthetic type (EC 2.2.1.6))

Software error:

../bin/blast/fastacmd -i /tmp/list.14454.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.14454.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.