GapMind for Amino acid biosynthesis

 

Alignments for a candidate for argC in Dechlorosoma suillum PS

Align N-acetyl-gamma-glutamyl-phosphate reductase; AGPR; EC 1.2.1.38; N-acetyl-glutamate semialdehyde dehydrogenase; NAGSA dehydrogenase (uncharacterized)
to candidate Dsui_0782 Dsui_0782 N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form

Query= curated2:Q8Y339
         (337 letters)



>FitnessBrowser__PS:Dsui_0782
          Length = 319

 Score =  382 bits (980), Expect = e-111
 Identities = 185/319 (57%), Positives = 243/319 (76%), Gaps = 4/319 (1%)

Query: 1   MAFKVFVDGQEGTTGLRLLDYLSQRDDIELLRIAEDRRKDPAERAKFLNAADVAFLCLPD 60
           M FKVF+DG+ GTTGL++ + LS R +IE+L I ED+RKDPA +A+++N+ADV FLCLPD
Sbjct: 1   MTFKVFIDGRHGTTGLKIDERLSIRPEIEILTIPEDKRKDPAVKAEYINSADVVFLCLPD 60

Query: 61  VASREAVSLV--DNPNTCIIDASTAFRTSDDWAYGLPELAPGQRERLRNSKRIAVPGCHA 118
            ASRE+V+L+   N  T  +DASTA RT+ DW YGLPEL  GQRER+  ++++AVPGCHA
Sbjct: 61  AASRESVALLAPGNTRTRFLDASTAHRTNPDWVYGLPELNGGQRERVAKAQKVAVPGCHA 120

Query: 119 SAFVLLMRPLVEAGIVPADYPITAFSLTGYSGGGKKMIADYL--AADNPKLQSPRPYALA 176
           S F++LM PLV  GIVP DYP++ +S+TGYSGGGK+MIA Y   A+    ++SPR YAL 
Sbjct: 121 SGFIMLMAPLVAGGIVPKDYPVSTYSITGYSGGGKEMIASYEEPASLPDAMKSPRFYALG 180

Query: 177 LTHKHLPEMRVQSKLALPPIFTPVVGNFLKGLAVTIGLHPQHLASKVSPADIAKVFADYY 236
           LTHKHLPEM++Q+ LA  P+FTP+VGNF +G+ V + L P+ L  KV+PAD+   +++YY
Sbjct: 181 LTHKHLPEMQMQTGLAHQPLFTPIVGNFAQGMVVAVPLLPRMLGKKVTPADLQAFYSEYY 240

Query: 237 QGEQFIRVAPADNVETLDNGFFDVQGANDTNRADLFVFGSDERMVVTARLDNLGKGAAGA 296
            GE F++V P D    LDNGF      NDTNRA++FVFG  E+++V +R DNLGKGA+GA
Sbjct: 241 AGEVFVKVMPLDAAPVLDNGFLPATACNDTNRAEIFVFGHGEQILVASRFDNLGKGASGA 300

Query: 297 AVQCMNVHLGVDEATSLHV 315
           A+QCMN+ LGVDEAT L V
Sbjct: 301 AIQCMNLMLGVDEATGLAV 319


Lambda     K      H
   0.320    0.136    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 363
Number of extensions: 12
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 337
Length of database: 319
Length adjustment: 28
Effective length of query: 309
Effective length of database: 291
Effective search space:    89919
Effective search space used:    89919
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate Dsui_0782 Dsui_0782 (N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form)
to HMM TIGR01851 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))

Software error:

../bin/blast/fastacmd -i /tmp/list.7138.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.7138.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.