Align Putative [LysW]-aminoadipate/[LysW]-glutamate kinase; EC 2.7.2.17; EC 2.7.2.19 (uncharacterized)
to candidate Dsui_1309 Dsui_1309 acetylglutamate kinase
Query= curated2:A9A1K7 (267 letters) >FitnessBrowser__PS:Dsui_1309 Length = 293 Score = 125 bits (313), Expect = 1e-33 Identities = 83/269 (30%), Positives = 143/269 (53%), Gaps = 22/269 (8%) Query: 2 ITIKIGGSVVDDLH-----PSTIADIKKIAESEGVILVHGGGKEVTKVCEQLGKEPKFVT 56 I +K GG+ + D H + +K + + V++VHGGG ++ + ++GK+ +F+ Sbjct: 28 IVVKYGGNAMTDEHLKQCFARDVVLLKLVGMN--VVVVHGGGPQIENMLGRVGKKGEFIQ 85 Query: 57 SPSGIKSRYTDKETAEIFTMVMSGRINKTIVQMLQKNGINAIGLSGVDAKVIEADRKKKL 116 R TD ET E+ MV+ G++NK +V ++ + G A+GL+G D +I A KKL Sbjct: 86 G-----MRVTDAETMEVVEMVLGGQVNKDVVNLINRAGGKAVGLTGKDGGMIRA---KKL 137 Query: 117 LIVNEKGRKQAIDGGYTGKIREVNASFIKSLLDQGLTPVISPIAISEESEFLNVDGDRAA 176 L+ N++ ID G G I +++ S I +L G PVI+PI + ++ E N++ D A Sbjct: 138 LLPNKENPDDLIDVGQVGDIVQIDPSLIGNLEGAGFIPVIAPIGVGKDGETYNINADVVA 197 Query: 177 AYVAGKVGSDKVLFITNVDGLLMDDKVVPKLTLAEAKEIRPKI-----GPGMEKKILAST 231 VA + ++K++ +TN G+L DK +T K+I + GM KI ++ Sbjct: 198 GKVAEVLKAEKLVLLTNTPGVL--DKAGQLITGITPKQIDDMVEDGTLSGGMLPKISSAL 255 Query: 232 EALDMGVTTALIANGQKENPISSAISHDN 260 +A GV + I +G+ E+ + I D+ Sbjct: 256 DAARNGVKSVHIIDGRVEHALLLEILTDH 284 Lambda K H 0.313 0.133 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 293 Length adjustment: 26 Effective length of query: 241 Effective length of database: 267 Effective search space: 64347 Effective search space used: 64347 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory