Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate Dsui_2381 Dsui_2381 phospho-2-dehydro-3-deoxyheptonate aldolase
Query= BRENDA::P00888 (356 letters) >FitnessBrowser__PS:Dsui_2381 Length = 358 Score = 383 bits (984), Expect = e-111 Identities = 194/352 (55%), Positives = 248/352 (70%), Gaps = 1/352 (0%) Query: 6 LNNVHITDEQVLMTPEQLKAAFPLSLQQEAQIADSRKSISDIIAGRDPRLLVVCGPCSIH 65 ++N++I + TP + A+ PLS + + R+ + +I+ +D RL VV GPCSIH Sbjct: 6 IDNINIAAFDPMPTPAAMLASQPLSEKAATVVRQGRQDLKNILDRKDHRLFVVVGPCSIH 65 Query: 66 DPETALEYARRFKALAAEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDVEAGLQ 125 DP L+YARR KALA EVSD+L LVMRVYFEKPRTTVGWKG INDP MD SF V+ G+ Sbjct: 66 DPVAGLDYARRLKALADEVSDTLLLVMRVYFEKPRTTVGWKGYINDPFMDDSFRVDVGMA 125 Query: 126 IARKLLLELVNMGLPLATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGLSMPVG 185 AR+ LL++ +GLP TEALDPNSPQY GDL SW+AIGARTTESQTHREM+SGLS PVG Sbjct: 126 KAREFLLQVNEIGLPAGTEALDPNSPQYYGDLISWTAIGARTTESQTHREMSSGLSTPVG 185 Query: 186 FKNGTDGSLATAINAMRAAAQPHRFVGINQAGQVALLQTQGNPDGHVILRGGKA-PNYSP 244 FKNGTDG+ AINA+ +A++PH F+G+N GQVA+++T GN GH++LRGG PNY Sbjct: 186 FKNGTDGNTEIAINAILSASKPHSFLGLNDQGQVAIVRTTGNAYGHIVLRGGGGRPNYDT 245 Query: 245 ADVAQCEKEMEQAGLRPSLMVDCSHGNSNKDYRRQPAVAESVVAQIKDGNRSIIGLMIES 304 V+ E+ M +A L P+++VDCSH NS K QP V VV QI+ GN+S++G+MIES Sbjct: 246 VSVSVAEQAMVKAKLIPNVVVDCSHANSLKKPELQPLVMSDVVNQIRLGNKSMVGVMIES 305 Query: 305 NIHEGNQSSEQPRSEMKYGVSVTDACISWEMTDALLREIHQDLNGQLTARVA 356 NI GNQS S++KYG SVTD C+ W T+ ++R+ L L R A Sbjct: 306 NIEAGNQSIPADLSQLKYGCSVTDGCVDWATTEKMIRDAATLLRDVLPERQA 357 Lambda K H 0.316 0.131 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 358 Length adjustment: 29 Effective length of query: 327 Effective length of database: 329 Effective search space: 107583 Effective search space used: 107583 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate Dsui_2381 Dsui_2381 (phospho-2-dehydro-3-deoxyheptonate aldolase)
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.31320.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-146 473.1 0.0 2.3e-146 472.9 0.0 1.0 1 lcl|FitnessBrowser__PS:Dsui_2381 Dsui_2381 phospho-2-dehydro-3-de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_2381 Dsui_2381 phospho-2-dehydro-3-deoxyheptonate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 472.9 0.0 2.3e-146 2.3e-146 1 338 [. 7 348 .. 7 352 .. 0.98 Alignments for each domain: == domain 1 score: 472.9 bits; conditional E-value: 2.3e-146 TIGR00034 1 ddlrivkidelltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyakrlkklaek 77 d+++i+++d++ tP+++ a pl+ekaa+ v++ r+++++il+ kd+rl+vv+GPcsihdp a l+ya+rlk+la++ lcl|FitnessBrowser__PS:Dsui_2381 7 DNINIAAFDPMPTPAAMLASQPLSEKAATVVRQGRQDLKNILDRKDHRLFVVVGPCSIHDPVAGLDYARRLKALADE 83 68999************************************************************************ PP TIGR00034 78 lkddleivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplatelldtispqyladllsw 154 ++d l +vmrvyfekPrttvGWkG indP +++sf+v+ G++ ar++ll+++e+glp++te+ld++spqy++dl+sw lcl|FitnessBrowser__PS:Dsui_2381 84 VSDTLLLVMRVYFEKPRTTVGWKGYINDPFMDDSFRVDVGMAKAREFLLQVNEIGLPAGTEALDPNSPQYYGDLISW 160 ***************************************************************************** PP TIGR00034 155 gaiGarttesqvhrelasglslpvgfkngtdGslkvaidairaaaaehlflsvtkaGqvaivetkGnedghiilrGG 231 +aiGarttesq+hre++sgls pvgfkngtdG++++ai+ai +a+++h fl+ +++Gqvaiv+t+Gn +ghi+lrGG lcl|FitnessBrowser__PS:Dsui_2381 161 TAIGARTTESQTHREMSSGLSTPVGFKNGTDGNTEIAINAILSASKPHSFLGLNDQGQVAIVRTTGNAYGHIVLRGG 237 ***************************************************************************99 PP TIGR00034 232 kk.pnydaedvaevkeelekaglkeelmidfshgnsnkdykrqlevaesvveqiaeGekaiiGvmiesnleeGnqsl 307 pnyd+ +v +++ + ka+l +++++d+sh+ns k+ + q+ v+++vv+qi+ G+k+++Gvmiesn+e Gnqs+ lcl|FitnessBrowser__PS:Dsui_2381 238 GGrPNYDTVSVSVAEQAMVKAKLIPNVVVDCSHANSLKKPELQPLVMSDVVNQIRLGNKSMVGVMIESNIEAGNQSI 314 877************************************************************************** PP TIGR00034 308 ...keelkyGksvtdacigwedteallrklaeav 338 ++lkyG+svtd c++w +te+++r+ a+ + lcl|FitnessBrowser__PS:Dsui_2381 315 padLSQLKYGCSVTDGCVDWATTEKMIRDAATLL 348 6544689********************9987655 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (358 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.52 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory