Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate Dsui_3444 Dsui_3444 phospho-2-dehydro-3-deoxyheptonate aldolase
Query= BRENDA::C3TIE2 (350 letters) >FitnessBrowser__PS:Dsui_3444 Length = 365 Score = 470 bits (1210), Expect = e-137 Identities = 231/344 (67%), Positives = 276/344 (80%) Query: 6 DDLRIKEIKELLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGPCSIHD 65 DD+RI+EIKEL+PP + ++P + AA T AR+ IH+IL G DDRLLVVIGPCSIHD Sbjct: 16 DDVRIREIKELVPPAHVFREYPVSNRAAQTTYGARQGIHRILHGADDRLLVVIGPCSIHD 75 Query: 66 PVAAKEYATRLLALREELKDELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQINDGLRI 125 AA EYA RL E LKD+L +VMRVYFEKPRTTVGWKGLINDP MD SF+IN+GLR+ Sbjct: 76 YEAAMEYAQRLQKEAERLKDDLLVVMRVYFEKPRTTVGWKGLINDPRMDGSFRINEGLRL 135 Query: 126 ARKLLLDINDSGLPAAGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLSCPVGF 185 ARK+LLDIN+ GL A EFLD I+PQY ADL++WGAIGARTTESQVHRELASGLSCPVGF Sbjct: 136 ARKILLDINELGLSCATEFLDTISPQYTADLIAWGAIGARTTESQVHRELASGLSCPVGF 195 Query: 186 KNGTDGTIKVAIDAINAAGAPHCFLSVTKWGHSAIVNTSGNGDCHIILRGGKEPNYSAKH 245 KNGTDG +++A+DAI +A APH FLSVTK GHSAIV+T+GN DCH+ILRGGK PNY A Sbjct: 196 KNGTDGNVRIAVDAIRSASAPHHFLSVTKGGHSAIVSTAGNEDCHVILRGGKGPNYDAAS 255 Query: 246 VAEVKEGLNKAGLPAQVMIDFSHANSSKQFKKQMDVCADVCQQIAGGEKAIIGVMVESHL 305 V + + AGL A++M+DFSHANSSK+F++Q+DV DV Q+A G++ IIGVMVESHL Sbjct: 256 VDAACKDIAAAGLAARLMVDFSHANSSKKFERQVDVAKDVATQLAAGDERIIGVMVESHL 315 Query: 306 VEGNQSLESGEPLAYGKSITDACIGWEDTDALLRQLANAVKARR 349 VEG Q + +PL YGKS+TDACIGWED+ +L LA AV+ RR Sbjct: 316 VEGRQDITPDKPLEYGKSVTDACIGWEDSVRVLDILARAVRERR 359 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 450 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 365 Length adjustment: 29 Effective length of query: 321 Effective length of database: 336 Effective search space: 107856 Effective search space used: 107856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate Dsui_3444 Dsui_3444 (phospho-2-dehydro-3-deoxyheptonate aldolase)
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.5550.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.1e-171 553.7 0.0 7e-171 553.5 0.0 1.0 1 lcl|FitnessBrowser__PS:Dsui_3444 Dsui_3444 phospho-2-dehydro-3-de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_3444 Dsui_3444 phospho-2-dehydro-3-deoxyheptonate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 553.5 0.0 7e-171 7e-171 1 342 [] 16 359 .. 16 359 .. 0.99 Alignments for each domain: == domain 1 score: 553.5 bits; conditional E-value: 7e-171 TIGR00034 1 ddlrivkidelltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyakrlkklaek 77 dd+ri +i+el++P+++ +++p++++aa++ +r+ i++il+G ddrllvviGPcsihd eaa+eya+rl+k ae+ lcl|FitnessBrowser__PS:Dsui_3444 16 DDVRIREIKELVPPAHVFREYPVSNRAAQTTYGARQGIHRILHGADDRLLVVIGPCSIHDYEAAMEYAQRLQKEAER 92 799************************************************************************** PP TIGR00034 78 lkddleivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplatelldtispqyladllsw 154 lkddl +vmrvyfekPrttvGWkGlindP +++sf++n+Glr+ark+lld++elgl ate+ldtispqy adl++w lcl|FitnessBrowser__PS:Dsui_3444 93 LKDDLLVVMRVYFEKPRTTVGWKGLINDPRMDGSFRINEGLRLARKILLDINELGLSCATEFLDTISPQYTADLIAW 169 ***************************************************************************** PP TIGR00034 155 gaiGarttesqvhrelasglslpvgfkngtdGslkvaidairaaaaehlflsvtkaGqvaivetkGnedghiilrGG 231 gaiGarttesqvhrelasgls+pvgfkngtdG++++a+dair+a+a+h+flsvtk G++aiv+t+Gned+h+ilrGG lcl|FitnessBrowser__PS:Dsui_3444 170 GAIGARTTESQVHRELASGLSCPVGFKNGTDGNVRIAVDAIRSASAPHHFLSVTKGGHSAIVSTAGNEDCHVILRGG 246 ***************************************************************************** PP TIGR00034 232 kkpnydaedvaevkeelekaglkeelmidfshgnsnkdykrqlevaesvveqiaeGekaiiGvmiesnleeGnqsl. 307 k pnyda++v+++++++ +agl ++lm+dfsh+ns+k+++rq++va++v+ q+a G++ iiGvm+es+l+eG+q++ lcl|FitnessBrowser__PS:Dsui_3444 247 KGPNYDAASVDAACKDIAAAGLAARLMVDFSHANSSKKFERQVDVAKDVATQLAAGDERIIGVMVESHLVEGRQDIt 323 ****************************************************************************8 PP TIGR00034 308 .keelkyGksvtdacigwedteallrklaeavkerr 342 +++l+yGksvtdacigwed+ ++l la+av+err lcl|FitnessBrowser__PS:Dsui_3444 324 pDKPLEYGKSVTDACIGWEDSVRVLDILARAVRERR 359 889******************************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (365 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.16 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory