Align cystathionine β-synthase (O-acetyl-L-serine) monomer (EC 4.2.1.22; EC 2.5.1.134; EC 2.5.1.47) (characterized)
to candidate Dsui_3208 Dsui_3208 cysteine synthase A
Query= metacyc::HP_RS00545-MONOMER (306 letters) >FitnessBrowser__PS:Dsui_3208 Length = 310 Score = 229 bits (585), Expect = 5e-65 Identities = 127/308 (41%), Positives = 179/308 (58%), Gaps = 6/308 (1%) Query: 1 MMIITTMQDAIGRTPVFKFTNKDYPIPLNSAIYAKLEHLNPGGSVKDRLGQYLIGEGFKT 60 M I + +G+TP+ + + + KLE+ NP SVKDR+ +I Sbjct: 1 MKIAKDVTQLVGKTPLVQLNR--VAAGIEGTVALKLEYFNPAHSVKDRIAVAMIDAAQAA 58 Query: 61 GKITSKTTIIEPTAGNTGIALALVAIKHHLKTIFVVPEKFSTEKQQIMRALGALVINTPT 120 GKI T ++EPT+GNTGI LA+V +K FV+PE S E++ +++A GA +I TP Sbjct: 59 GKIKPDTIVLEPTSGNTGIGLAMVCAARGIKAAFVMPETMSRERKLLLKAYGAELILTPG 118 Query: 121 SEGISGAIKKSKELAESIPDSYLPLQFENPDNPAAYYHTLAPEIVQELGTNLTSFVAGIG 180 EG+ GAIKK++ELAES ++P QFENP NP + +T A EI + + FVAG+G Sbjct: 119 PEGMGGAIKKAQELAESDSRYFIPQQFENPANPEVHRNTTAEEIWADTDGQVDIFVAGVG 178 Query: 181 SGGTFAGTARYLKERIPAIRLIGVEPEGS-ILNGGEPGPHEIEGIGVEFIPPFFENLDID 239 +GGT G LK R P +++ VEP+ S +L+GG GPH I+GIG F+P D Sbjct: 179 TGGTVTGVGEVLKARKPGVQVFAVEPDASPVLSGGAKGPHPIQGIGAGFVPAVLNTQVYD 238 Query: 240 GFETISDEEGFSYTRKLAKKNGLLVGSSSGAAFVAALKEAQRLPE--GSQVLTIFPDVAD 297 G + +++ F+ R+LA + GLLVG SSGAA AAL E R PE G + + P + Sbjct: 239 GVVRVKNDDAFATARRLATEEGLLVGISSGAAVWAAL-EIARKPENKGKLTVVVIPSFGE 297 Query: 298 RYLSKGIY 305 RYLS +Y Sbjct: 298 RYLSTALY 305 Lambda K H 0.316 0.137 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 306 Length of database: 310 Length adjustment: 27 Effective length of query: 279 Effective length of database: 283 Effective search space: 78957 Effective search space used: 78957 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory