Align Serine O-succinyltransferase; SST; Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.-; EC 2.3.1.46 (characterized)
to candidate Dsui_0741 Dsui_0741 homoserine O-acetyltransferase
Query= SwissProt::S2KHP1 (367 letters) >FitnessBrowser__PS:Dsui_0741 Length = 375 Score = 262 bits (670), Expect = 1e-74 Identities = 145/365 (39%), Positives = 212/365 (58%), Gaps = 9/365 (2%) Query: 2 PDARRFIELPGPVRMYRGGELPSVTIAYETWGELRGQGDNALLLFTGLSPSAHAASSMAD 61 P F E P+++ G L + + YET+G L NA+L+ LS S H A AD Sbjct: 12 PQRAHFAE---PIQLASGATLAAYDLVYETYGRLNADRSNAVLVCHALSGSHHVAGHYAD 68 Query: 62 --PSPGWWEYMIGPGKPIDTERFFVIAINSLGSCFGSTGPASINPATGQPYRLDFPKLSV 119 + GWW+ ++GPGKP+DT++FFV+ +N+LG C+GSTGP SINPATG+PY DFP ++V Sbjct: 69 NPKNVGWWDNLVGPGKPLDTDKFFVVGVNNLGGCYGSTGPGSINPATGKPYGADFPVVTV 128 Query: 120 EDIVAAARGACRALGIDHVHTVAGASLGGMDALAYAVMYPGTYRDIISISAAAHATPFTI 179 ED V + LGI+ + G SLGGM AL +++ YP R + I++A T I Sbjct: 129 EDWVESQARLADRLGINQWAAIIGGSLGGMQALQWSLEYPERVRHALVIASAPKLTAQNI 188 Query: 180 ALRSIQREAVRADPAWAGGN-YAPGEGPKDGMRVARQLGILTYRSAEEWLQRFDRERLEG 238 A + R+A+ DP + GGN Y G P G+R+AR +G +TY S ++ ++F R+ EG Sbjct: 189 AFNEVARQAILTDPDFHGGNYYEHGVVPARGLRLARMVGHITYLSDDQMGEKFGRQLREG 248 Query: 239 SDDSANPFAMAFQVQSYMEANARKFADRFDANCYLYLSQAMDLFDMAEHGDGSLEAAVRR 298 + + F+++SY+ KFA FDAN YL ++A+D FD A G L+AA+ R Sbjct: 249 V--LKYNYDVDFEIESYLRYQGDKFAGFFDANTYLITTKALDYFDPARDFGGDLKAALAR 306 Query: 299 IDAKRALVAGVTTDWLFPLWQQRQVAELLEHAGVAVSYHELGSIQGHDAFLVDSERFAPM 358 AK LV+ TTDW F + R++ L H VSY E+ GHD+FL+D ++ + Sbjct: 307 ASAKFLLVS-FTTDWRFAPERSREMVYALLHNNREVSYAEIDCNAGHDSFLLDDAQYHAV 365 Query: 359 VAEFL 363 + +L Sbjct: 366 MGAYL 370 Lambda K H 0.320 0.135 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 375 Length adjustment: 30 Effective length of query: 337 Effective length of database: 345 Effective search space: 116265 Effective search space used: 116265 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory