Align Serine acetyltransferase; SAT; EC 2.3.1.30 (uncharacterized)
to candidate Dsui_1099 Dsui_1099 UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase
Query= curated2:Q65PC9 (216 letters) >FitnessBrowser__PS:Dsui_1099 Length = 452 Score = 47.4 bits (111), Expect = 4e-10 Identities = 39/127 (30%), Positives = 61/127 (48%), Gaps = 9/127 (7%) Query: 57 ISQIARFFTGIEIHPGAKIGRRFFIDH---GMGVVIGETCEIGNNVTVFQGVTLG-GT-- 110 + AR G E+ A +G + + G G +G+ TV Q V +G GT Sbjct: 321 VGPYARLRPGTELGAEAHVGNFVELKNSILGPGSKANHLAYVGD-ATVGQRVNIGAGTIT 379 Query: 111 -GKEKGKRHPT-IEDDALISTGAKVLGSITVGRGAKIGAGSVVLHDVPECSTVVGIPGRV 168 + +H T IEDDA I + ++++ +TVGRGA +GAG+ + D P S V +V Sbjct: 380 CNYDGANKHRTVIEDDAFIGSDSQLVAPVTVGRGATLGAGTTLTKDAPADSLTVSRARQV 439 Query: 169 VVQNGKK 175 + K+ Sbjct: 440 SLAGWKR 446 Lambda K H 0.323 0.142 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 216 Length of database: 452 Length adjustment: 27 Effective length of query: 189 Effective length of database: 425 Effective search space: 80325 Effective search space used: 80325 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory