Align Cysteine synthase; CSase; O-acetylserine (thiol)-lyase; OAS-TL; O-acetylserine sulfhydrylase; EC 2.5.1.47 (characterized)
to candidate Dsui_2521 Dsui_2521 cysteine synthase A
Query= SwissProt::Q59966 (329 letters) >FitnessBrowser__PS:Dsui_2521 Length = 328 Score = 520 bits (1338), Expect = e-152 Identities = 257/328 (78%), Positives = 293/328 (89%) Query: 1 MSTSGTFFADNSQTIGKTPLVRLNRIVKGAPATVLAKIEGRNPAYSVKCRIGAAMIWDAE 60 M + +F+DNS++IG+TPLVRLNR+ GAPATVLAKIEGRNPAYSVKCRIGAAM+WDAE Sbjct: 1 MKSMSNWFSDNSRSIGRTPLVRLNRVTDGAPATVLAKIEGRNPAYSVKCRIGAAMVWDAE 60 Query: 61 QRGLLGPGKELIEPTSGNTGIALAFVAAARGIPLTLTMPETMSLERRKLLAAYGAKLVLT 120 RGLLGPGKEL+EPTSGNTGIALAFVAA GIPLTLTMPETMSLERRKLLAAYGAKLVLT Sbjct: 61 IRGLLGPGKELVEPTSGNTGIALAFVAAVYGIPLTLTMPETMSLERRKLLAAYGAKLVLT 120 Query: 121 EGVKGMTGAVRRAEDIAASDPDRYVLLQQFRNPANPAIHEQTTGPEIWEDTGGAIDILVS 180 EG KGM GA+ +AE+IAASDP +YVLLQQF+NPANPAIHE TTGPEIW DT +DI VS Sbjct: 121 EGTKGMGGAIAKAEEIAASDPGKYVLLQQFKNPANPAIHESTTGPEIWIDTDDKVDIFVS 180 Query: 181 GVGTGGTITGVSRYIKQTQGKPILSVAVEPEASPVISQQRSGLPLKPGPHKIQGIGAGFI 240 GVGTGGTITGVSRY K+T+G + SVAVEP ASPV++Q R+G P+KPGPHKIQGIGAGF+ Sbjct: 181 GVGTGGTITGVSRYFKKTRGAKLWSVAVEPSASPVLTQTRNGEPVKPGPHKIQGIGAGFV 240 Query: 241 PENLDLSLVDQVERVSNEEAIAYARRLAQEEGLISGISCGAAVAAAVRLAQQSEHAGKTI 300 P+ LDLSL+D +E+VSNEEA+AYARRLA+EEG+ISGIS GAAVA A RLAQ+ E+AGKTI Sbjct: 241 PQVLDLSLIDAIEQVSNEEAVAYARRLAREEGIISGISSGAAVAVASRLAQRRENAGKTI 300 Query: 301 VVVLPDSGERYLSTALFDGIFNEQGLAV 328 VV+LPDSGERYLS+ LF+G+FNE GL V Sbjct: 301 VVILPDSGERYLSSVLFEGVFNEAGLPV 328 Lambda K H 0.316 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 328 Length adjustment: 28 Effective length of query: 301 Effective length of database: 300 Effective search space: 90300 Effective search space used: 90300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate Dsui_2521 Dsui_2521 (cysteine synthase A)
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.6923.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9e-139 447.8 0.1 1e-138 447.6 0.1 1.0 1 lcl|FitnessBrowser__PS:Dsui_2521 Dsui_2521 cysteine synthase A Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_2521 Dsui_2521 cysteine synthase A # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 447.6 0.1 1e-138 1e-138 2 298 .] 12 317 .. 11 317 .. 0.99 Alignments for each domain: == domain 1 score: 447.6 bits; conditional E-value: 1e-138 TIGR01139 2 seliGntPlvrLn.laeeakaevlvkleslnPsssvkdrialamiedaekegllkkgktiveatsGntGialamvaa 77 s+ iG+tPlvrLn ++++a a vl+k+e +nP++svk+ri++am++dae +gll +gk++ve+tsGntGiala+vaa lcl|FitnessBrowser__PS:Dsui_2521 12 SRSIGRTPLVRLNrVTDGAPATVLAKIEGRNPAYSVKCRIGAAMVWDAEIRGLLGPGKELVEPTSGNTGIALAFVAA 88 679**********9999************************************************************ PP TIGR01139 78 argykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnkylllkqfenpanpeihrkttap 154 g l+ltmpetmslerrkll ayGa+lvLt+g++gm gai+kaee+++++p ky+ll+qf+npanp+ih++tt+p lcl|FitnessBrowser__PS:Dsui_2521 89 VYGIPLTLTMPETMSLERRKLLAAYGAKLVLTEGTKGMGGAIAKAEEIAASDPGKYVLLQQFKNPANPAIHESTTGP 165 ***************************************************************************** PP TIGR01139 155 eilkdldgkldafvagvGtGGtitGvgevlkekkp.dikvvavePaespvlsgg......kpgphkiqGigagfiPk 224 ei+ d+d+k+d+fv+gvGtGGtitGv++++k++++ ++ +vaveP++spvl+++ kpgphkiqGigagf+P+ lcl|FitnessBrowser__PS:Dsui_2521 166 EIWIDTDDKVDIFVSGVGTGGTITGVSRYFKKTRGaKLWSVAVEPSASPVLTQTrngepvKPGPHKIQGIGAGFVPQ 242 *********************************998*****************99999******************* PP TIGR01139 225 vLdkevidevikvsdeeaietarrlakeeGilvGissGaavaaalkvakkle.kdkkivvilpdtgerYlstaLf 298 vLd ++id + +vs+eea+++arrla+eeGi++GissGaava a ++a++ e ++k+ivvilpd+gerYls Lf lcl|FitnessBrowser__PS:Dsui_2521 243 VLDLSLIDAIEQVSNEEAVAYARRLAREEGIISGISSGAAVAVASRLAQRREnAGKTIVVILPDSGERYLSSVLF 317 *************************************************9999*******************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (328 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 8.53 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory