Align cysteine synthase (EC 2.5.1.47) (characterized)
to candidate Dsui_3208 Dsui_3208 cysteine synthase A
Query= BRENDA::P9WP55 (310 letters) >FitnessBrowser__PS:Dsui_3208 Length = 310 Score = 436 bits (1121), Expect = e-127 Identities = 214/305 (70%), Positives = 251/305 (82%) Query: 1 MSIAEDITQLIGRTPLVRLRRVTDGAVADIVAKLEFFNPANSVKDRIGVAMLQAAEQAGL 60 M IA+D+TQL+G+TPLV+L RV G + KLE+FNPA+SVKDRI VAM+ AA+ AG Sbjct: 1 MKIAKDVTQLVGKTPLVQLNRVAAGIEGTVALKLEYFNPAHSVKDRIAVAMIDAAQAAGK 60 Query: 61 IKPDTIILEPTSGNTGIALAMVCAARGYRCVLTMPETMSLERRMLLRAYGAELILTPGAD 120 IKPDTI+LEPTSGNTGI LAMVCAARG + MPETMS ER++LL+AYGAELILTPG + Sbjct: 61 IKPDTIVLEPTSGNTGIGLAMVCAARGIKAAFVMPETMSRERKLLLKAYGAELILTPGPE 120 Query: 121 GMSGAIAKAEELAKTDQRYFVPQQFENPANPAIHRVTTAEEVWRDTDGKVDIVVAGVGTG 180 GM GAI KA+ELA++D RYF+PQQFENPANP +HR TTAEE+W DTDG+VDI VAGVGTG Sbjct: 121 GMGGAIKKAQELAESDSRYFIPQQFENPANPEVHRNTTAEEIWADTDGQVDIFVAGVGTG 180 Query: 181 GTITGVAQVIKERKPSARFVAVEPAASPVLSGGQKGPHPIQGIGAGFVPPVLDQDLVDEI 240 GT+TGV +V+K RKP + AVEP ASPVLSGG KGPHPIQGIGAGFVP VL+ + D + Sbjct: 181 GTVTGVGEVLKARKPGVQVFAVEPDASPVLSGGAKGPHPIQGIGAGFVPAVLNTQVYDGV 240 Query: 241 ITVGNEDALNVARRLAREEGLLVGISSGAATVAALQVARRPENAGKLIVVVLPDFGERYL 300 + V N+DA ARRLA EEGLLVGISSGAA AAL++AR+PEN GKL VVV+P FGERYL Sbjct: 241 VRVKNDDAFATARRLATEEGLLVGISSGAAVWAALEIARKPENKGKLTVVVIPSFGERYL 300 Query: 301 STPLF 305 ST L+ Sbjct: 301 STALY 305 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 310 Length adjustment: 27 Effective length of query: 283 Effective length of database: 283 Effective search space: 80089 Effective search space used: 80089 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate Dsui_3208 Dsui_3208 (cysteine synthase A)
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.749.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-143 461.2 0.3 8.2e-143 461.0 0.3 1.0 1 lcl|FitnessBrowser__PS:Dsui_3208 Dsui_3208 cysteine synthase A Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_3208 Dsui_3208 cysteine synthase A # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 461.0 0.3 8.2e-143 8.2e-143 2 298 .] 8 305 .. 7 305 .. 0.99 Alignments for each domain: == domain 1 score: 461.0 bits; conditional E-value: 8.2e-143 TIGR01139 2 seliGntPlvrLn.laeeakaevlvkleslnPsssvkdrialamiedaekegllkkgktiveatsGntGialamvaa 77 ++l+G+tPlv+Ln +a+++++ v++kle++nP++svkdria+ami a+ +g++k+++ ++e+tsGntGi+lamv+a lcl|FitnessBrowser__PS:Dsui_3208 8 TQLVGKTPLVQLNrVAAGIEGTVALKLEYFNPAHSVKDRIAVAMIDAAQAAGKIKPDTIVLEPTSGNTGIGLAMVCA 84 789**********999************************************************************* PP TIGR01139 78 argykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnkylllkqfenpanpeihrkttap 154 arg k+ +mpetms er+ llkayGael+Lt+g egm gai+ka+el+e+++ +y++++qfenpanpe+hr+tta+ lcl|FitnessBrowser__PS:Dsui_3208 85 ARGIKAAFVMPETMSRERKLLLKAYGAELILTPGPEGMGGAIKKAQELAESDS-RYFIPQQFENPANPEVHRNTTAE 160 **************************************************999.899******************** PP TIGR01139 155 eilkdldgkldafvagvGtGGtitGvgevlkekkpdikvvavePaespvlsggkpgphkiqGigagfiPkvLdkevi 231 ei+ d+dg++d+fvagvGtGGt+tGvgevlk kp ++v+aveP +spvlsgg +gph iqGigagf+P+vL+++v+ lcl|FitnessBrowser__PS:Dsui_3208 161 EIWADTDGQVDIFVAGVGTGGTVTGVGEVLKARKPGVQVFAVEPDASPVLSGGAKGPHPIQGIGAGFVPAVLNTQVY 237 ***************************************************************************** PP TIGR01139 232 devikvsdeeaietarrlakeeGilvGissGaavaaalkvakkle.kdkkivvilpdtgerYlstaLf 298 d v++v++++a++tarrla+eeG+lvGissGaav+aal++a+k+e k+k+ vv++p++gerYlstaL+ lcl|FitnessBrowser__PS:Dsui_3208 238 DGVVRVKNDDAFATARRLATEEGLLVGISSGAAVWAALEIARKPEnKGKLTVVVIPSFGERYLSTALY 305 ********************************************99********************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (310 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 9.51 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory