Align glutamyl-tRNAGln amidotransferase subunit B (EC 6.3.5.7) (characterized)
to candidate Dsui_0884 Dsui_0884 glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B subunit
Query= metacyc::MONOMER-13956 (476 letters) >FitnessBrowser__PS:Dsui_0884 Length = 485 Score = 445 bits (1144), Expect = e-129 Identities = 234/476 (49%), Positives = 325/476 (68%), Gaps = 9/476 (1%) Query: 2 NFETVIGLEVHVELKTKSKIFSSSPTPFGAEANTQTSVIDLGYPGVLPVLNKEAVEFAMK 61 N+E VIG+E H +L T+SKIFS S T FGA+ N Q S +DL PGVLPVLN+ AVE A+K Sbjct: 5 NWEVVIGIETHAQLSTQSKIFSGSSTAFGAQPNVQASAVDLALPGVLPVLNRGAVECAIK 64 Query: 62 AAMALNCEIATDTKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEVGGKTKR----IG 117 +++ E+A + F RKNYFYPD PK YQISQF+ P+ G + I+VG K + Sbjct: 65 FGLSIGAEVAAKSVFARKNYFYPDLPKGYQISQFELPVVVGGGVRIQVGQGDKAYEKVVR 124 Query: 118 ITRLHLEEDAGKLTHTG-DGYSLVDFNRQGTPLVEIVSEPDIRTPEEAYAYLEKLKSIIQ 176 +TR HLEEDAGK H G S +D NR GTPL+EIV+EPD+ + EA AY + L ++++ Sbjct: 125 LTRAHLEEDAGKSLHEDFHGKSGIDLNRAGTPLLEIVTEPDMCSSAEAVAYAKALHALVR 184 Query: 177 YTGVSDCKMEEGSLRCDANISLRPIGQEEFGTKTELKNLNSFAFVQKGLEHEEKRQEQVL 236 + G+ D M+EGS RCDAN+S+R G E GT+ E+KNLNSF F+Q+ +++E + Q L Sbjct: 185 WIGICDGNMQEGSFRCDANVSVRRPG-EPLGTRREIKNLNSFRFLQQAIDYEIQWQIDTL 243 Query: 237 LSGFFIQQETRRYDEATKKTILMRVKEGSDDYRYFPEPDLVELYIDDEWKERVKASIPEL 296 G IQQ T +D + +T +MR KE + DYRYFP+PDL+ L I EW ER KA++PEL Sbjct: 244 EDGGKIQQATVLFDPDSGETRVMRTKEDAHDYRYFPDPDLLPLVISREWVERTKATLPEL 303 Query: 297 PDERRKRYIEELGFAAYDAMVLTLTKEMADFFEE--TVQKGAEAKQASNWLMGEVSAYLN 354 P+ +R+R++E+LG +AYDA LT + E+AD+F+ T A AK A+NW+MGE+SA LN Sbjct: 304 PEAKRQRFMEQLGLSAYDATALTASLEVADYFDAVVTAAGAANAKSAANWVMGELSARLN 363 Query: 355 AEQKELADVALTPEGLAGMIKLIEKGTISSKIAKKVFKELIE-KGGDAEKIVKEKGLVQI 413 E K++A ++ LAG+I I TIS+ IAKKVF+ L G A+++++++GL QI Sbjct: 364 KEDKDIAASPVSAAQLAGLIARIADNTISNNIAKKVFEALWNGDGASADEVIEKQGLKQI 423 Query: 414 SDEGVLLKLVTEALDNNPQSIEDFKNGKDRAIGFLVGQIMKASKGQANPPMVNKIL 469 +D G + KLV E L N ++ ++K GK++A LVGQ+MKA+KG+ANP VN +L Sbjct: 424 TDTGAIEKLVDEVLAANAANVAEYKAGKEKAFNALVGQVMKAAKGKANPQQVNDLL 479 Lambda K H 0.314 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 560 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 476 Length of database: 485 Length adjustment: 34 Effective length of query: 442 Effective length of database: 451 Effective search space: 199342 Effective search space used: 199342 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 51 (24.3 bits)
Align candidate Dsui_0884 Dsui_0884 (glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B subunit)
to HMM TIGR00133 (gatB: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit (EC 6.3.5.-))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00133.hmm # target sequence database: /tmp/gapView.24806.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00133 [M=481] Accession: TIGR00133 Description: gatB: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-165 535.0 0.0 8.5e-165 534.8 0.0 1.0 1 lcl|FitnessBrowser__PS:Dsui_0884 Dsui_0884 glutamyl-tRNA(Gln) and Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_0884 Dsui_0884 glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 534.8 0.0 8.5e-165 8.5e-165 3 480 .. 5 483 .. 3 484 .. 0.97 Alignments for each domain: == domain 1 score: 534.8 bits; conditional E-value: 8.5e-165 TIGR00133 3 eyelviGlEvHvqlntksKlFckcsneaqeakpNtnvcpvclglPGalPvlNkeavkkAlklalalnskivsevsvF 79 ++e+viG+E+H ql t+sK+F+ +s+ + +pN + ++v+l+lPG+lPvlN+ av+ A+k +l +++++ +svF lcl|FitnessBrowser__PS:Dsui_0884 5 NWEVVIGIETHAQLSTQSKIFSGSSTAFGA-QPNVQASAVDLALPGVLPVLNRGAVECAIKFGLSIGAEVA-AKSVF 79 789*************************99.9*************************************55.6**** PP TIGR00133 80 dRKhYfYpDlPkgyqitqqdlPiaedGkleieleeke....keigierlhlEeDtgksqykesdkdkqslvDfNRsg 152 +RK+YfYpDlPkgyqi+q++lP++ +G ++i++ +++ k ++++r hlEeD+gks ++ + s +D+NR+g lcl|FitnessBrowser__PS:Dsui_0884 80 ARKNYFYPDLPKGYQISQFELPVVVGGGVRIQVGQGDkayeKVVRLTRAHLEEDAGKSLHEDF--HGKSGIDLNRAG 154 ********************************99888788899*****************954..5799******** PP TIGR00133 153 vPLlEiVtkPdlksakearaflkklrqilryleisdgdleeGsmRvDvNvsirlkGqekegtrvEiKNlnslksiek 229 +PLlEiVt+Pd+ s+ ea+a+ k l++++r+++i dg+++eGs+R+D+Nvs+r e gtr EiKNlns++ +++ lcl|FitnessBrowser__PS:Dsui_0884 155 TPLLEIVTEPDMCSSAEAVAYAKALHALVRWIGICDGNMQEGSFRCDANVSVRRP-GEPLGTRREIKNLNSFRFLQQ 230 *****************************************************55.577999*************** PP TIGR00133 230 aieyEieRqkkllkkgeevkqetrafdekksitvslRkKeeseDYRYfpePdlppieideevvkekveeklpelPea 306 ai+yEi+ q++ l++g +++q+t fd + t +R Ke+++DYRYfp+Pdl p++i+ e+v++ ++++lpelPea lcl|FitnessBrowser__PS:Dsui_0884 231 AIDYEIQWQIDTLEDGGKIQQATVLFDPDSGETRVMRTKEDAHDYRYFPDPDLLPLVISREWVER-TKATLPELPEA 306 ****************************************************************9.99********* PP TIGR00133 307 krirlkkeyglseedakvlvsdlelldafeevvklikep..klavnWileellgeLnkkkislaeallkpeelaeli 381 kr+r+++++gls++da l++ le++d+f+ vv++++ + k a+nW++ el ++Lnk++ ++a++ +++ +la li lcl|FitnessBrowser__PS:Dsui_0884 307 KRQRFMEQLGLSAYDATALTASLEVADYFDAVVTAAGAAnaKSAANWVMGELSARLNKEDKDIAASPVSAAQLAGLI 383 *********************************998766669*********************************** PP TIGR00133 382 klikegkisqksakelleellen.kkdpkklieklgliqisdekelvkiveevikenpkevekyksgkekalkflvG 457 + i +++is+ +ak+++e l + + +++++iek+gl qi+d+ ++ k+v+ev++ n+ +v +yk+gkeka++ lvG lcl|FitnessBrowser__PS:Dsui_0884 384 ARIADNTISNNIAKKVFEALWNGdGASADEVIEKQGLKQITDTGAIEKLVDEVLAANAANVAEYKAGKEKAFNALVG 460 ******************999866999************************************************** PP TIGR00133 458 qvmkktkgradpkevekllkell 480 qvmk +kg+a+p++v+ llk +l lcl|FitnessBrowser__PS:Dsui_0884 461 QVMKAAKGKANPQQVNDLLKAKL 483 *******************9887 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (481 nodes) Target sequences: 1 (485 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 10.66 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory