Align histidinol-phosphatase (EC 3.1.3.15) (characterized)
to candidate Dsui_2366 Dsui_2366 inositol monophosphatase/fructose-1,6-bisphosphatase family protein
Query= BRENDA::P95189 (260 letters) >FitnessBrowser__PS:Dsui_2366 Length = 267 Score = 99.0 bits (245), Expect = 9e-26 Identities = 83/247 (33%), Positives = 114/247 (46%), Gaps = 26/247 (10%) Query: 3 HDDLMLALALADRADELTRVRFGALDL-RIDTKPDLTPVTDADRAVESDVRQTLGRDRPG 61 H L +A+ A RA ++ +DL ++ K VT+ DRA E+ + +TL P Sbjct: 2 HPTLNIAVKAARRAGQIINRASNDIDLLKVVAKQQSDFVTEVDRAAEAAIIETLREAYPN 61 Query: 62 DGVLGEEFGGSTTFTGR----QWIVDPIDGTKNFVRGVPVWASLIALLEDGVPSVGVVSA 117 G+L EE G S GR QWI+DP+DGT NF+ G P +A IAL G + VV Sbjct: 62 HGILAEESGASV---GRDEEYQWIIDPLDGTTNFIHGFPQYAISIALAHRGQVTQAVVYD 118 Query: 118 PALQRRWWAARGRGAFASVDGARPHRLSVSSVAELHSASL-------SFSSLSGWARPGL 170 P + A +G GAF R+ V A+L A + SF + + Sbjct: 119 PIRNEMFTATKGAGAFLD-----DRRIRVGKRAKLQDALIGTGFPYRSFDHVDAYL---- 169 Query: 171 RERFIGLTDTVWRVRAYG-DFLSYCLVAEGAVDIAAEPQVSVWDLAALDIVVREAGGRLT 229 F LT T +R G L VA G +D E +S WD+AA +++ EAGG T Sbjct: 170 -NIFKELTQTCAGIRRPGAAALDLAWVACGRLDGFWEFGLSPWDMAAGTLLITEAGGLAT 228 Query: 230 SLDGVAG 236 L G G Sbjct: 229 DLAGEPG 235 Lambda K H 0.319 0.136 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 267 Length adjustment: 25 Effective length of query: 235 Effective length of database: 242 Effective search space: 56870 Effective search space used: 56870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory