Align 3-isopropylmalate dehydratase small subunit 1; EC 4.2.1.33; Alpha-IPM isomerase 1; IPMI 1; Isopropylmalate isomerase 1 (uncharacterized)
to candidate Dsui_2347 Dsui_2347 aconitate hydratase 1
Query= curated2:Q9RTY5 (177 letters) >FitnessBrowser__PS:Dsui_2347 Length = 898 Score = 43.5 bits (101), Expect = 1e-08 Identities = 31/99 (31%), Positives = 48/99 (48%), Gaps = 15/99 (15%) Query: 52 VLIGGRNWGLGSSREYAPQALKKLHIGGIVAPSFARIHYRNLLNLGIPAFEY----DLTE 107 ++ G +G GSSR++A + + L + +VA SF RIH NL+ +G+ ++ Sbjct: 771 LVFAGEEYGTGSSRDWAAKGTRLLGVRAVVARSFERIHRANLVGMGVLPLQFKAGTSAAS 830 Query: 108 LLEDGDE--------VTLDAQTGL---LTYADGTVQLPP 135 L DG E L AQ L +T +DG V+ P Sbjct: 831 LGLDGSEHFDLPGADGPLQAQQDLMLRITRSDGRVEQVP 869 Lambda K H 0.318 0.139 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 405 Number of extensions: 25 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 177 Length of database: 898 Length adjustment: 30 Effective length of query: 147 Effective length of database: 868 Effective search space: 127596 Effective search space used: 127596 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory