Align LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 (uncharacterized)
to candidate Dsui_2708 Dsui_2708 succinyldiaminopimelate transaminase
Query= curated2:C6BUK3 (388 letters) >FitnessBrowser__PS:Dsui_2708 Length = 401 Score = 179 bits (454), Expect = 1e-49 Identities = 130/394 (32%), Positives = 197/394 (50%), Gaps = 26/394 (6%) Query: 10 LATLPPYLFAEIDRLKAEVAAQ-GVDIISLGIGDPDLPTPDFIIEALHKAAKNPVNHQYP 68 LA L PY F ++ +L V I L IG+P TP FI EAL N YP Sbjct: 5 LAKLQPYPFEKLRQLFQGVTPNPDYQEIKLSIGEPQHATPGFIKEALTANLGGLAN--YP 62 Query: 69 SYVGLLTFRQAVADWYKERFDVE-LDATKEVVSLIGSKEGIAHFPLAFVNP--GDLVLVA 125 + G RQA+A W + R+ + ++ E++ + GS+E + F ++P G + LV Sbjct: 63 TSQGTPALRQAIAAWMERRYGLAGVNPDTEILPVNGSREALFAFAQTVIDPSRGYVPLVV 122 Query: 126 SPN--YPVYPVASGFAGGEVEIVPLLEENDFLPNLDAISDEKWDKCKIFFVNYPNNPTSA 183 SPN Y +Y A+ AG E + L ENDF L+A+S+ W + ++ +V P NPT Sbjct: 123 SPNPFYQIYEGAAYLAGAEPYFLNTLPENDFSLELEALSEADWARVQLLYVCSPGNPTGK 182 Query: 184 TATPEFYAELVAKAKKHNVIIAADAAYTEVYYDEDKKPISILETPGAKDVA------IEF 237 E + +L A + K+ +IA+D Y+E+Y+DE K P+ L+ AK + + F Sbjct: 183 VLDLEDWKKLFALSDKYGFVIASDECYSEIYFDEAKPPLGGLQ--AAKQLGRGFERLVMF 240 Query: 238 HSLSKTYNMTGWRCGMAVGNASLVAGLGKIKENVDSGIFQAVQEAGIVALKEGEPYVKEF 297 SLSK N+ G R G G+A+++ + + AVQ A +A E E + +E Sbjct: 241 SSLSKRSNVPGLRSGFVAGDAAVLKKFLLYRTYHGGAMNPAVQAASAIAWNE-EAHAREN 299 Query: 298 RKIYKERRDCVIEALEKINISCKVPDASIFVWAKTPEGYTSSEFVSKLLKETGVVVTPGN 357 R+ YKE+ D V + + + +PDAS ++WA+TP +EF +LL + VVV PG+ Sbjct: 300 RRQYKEKFDAVTPIVASV-LQTGLPDASFYLWARTP--IADTEFARRLLADYNVVVLPGS 356 Query: 358 GFGES------GEGYFRISLTVDTDRLKEAVSRI 385 GE + RI+L EA RI Sbjct: 357 YLAREARGVNPGENFVRIALVAPLADCLEAAERI 390 Lambda K H 0.317 0.136 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 477 Number of extensions: 27 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 401 Length adjustment: 31 Effective length of query: 357 Effective length of database: 370 Effective search space: 132090 Effective search space used: 132090 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory