GapMind for Amino acid biosynthesis

 

Alignments for a candidate for asd in Dechlorosoma suillum PS

Align Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 (characterized)
to candidate Dsui_3197 Dsui_3197 aspartate-semialdehyde dehydrogenase, gamma-proteobacterial

Query= SwissProt::Q51344
         (370 letters)



>FitnessBrowser__PS:Dsui_3197
          Length = 377

 Score =  535 bits (1377), Expect = e-156
 Identities = 266/376 (70%), Positives = 310/376 (82%), Gaps = 7/376 (1%)

Query: 1   MKRVGLIGWRGMVGSVLMQRMLEERDFDLIEPVFFTTSNVGGQGPEVG--KDIAPLKDAY 58
           MKRVGL+GWRGMVGSVLMQRM+EE DF  IEPV+F+TSN GG+ P  G  +  APL+DA 
Sbjct: 1   MKRVGLVGWRGMVGSVLMQRMVEEGDFAHIEPVYFSTSNAGGKAPVFGGKEAAAPLQDAI 60

Query: 59  SIDELKTLDVILTCQGGDYTSEVFPKLREAGWQGYWIDAASSLRMEDDAVIVLDPVNRKV 118
           S+D LKT D+I+TCQGGDYT EVFPKLR AGW G+WIDAAS+LRM DDAVI+LDPVN+ V
Sbjct: 61  SVDALKTCDIIITCQGGDYTKEVFPKLRAAGWNGHWIDAASALRMADDAVIILDPVNKNV 120

Query: 119 IDQALDAGTRNYIGGNCTVSLMLMALGGLFDAGLVEWMSAMTYQAASGAGAQNMRELLKQ 178
           I  +L  G +N+IGGNCTVSLMLM LGGLF   L+EW ++MTYQAASGAGAQNMREL+ Q
Sbjct: 121 IQDSLAKGGKNWIGGNCTVSLMLMGLGGLFQNDLIEWATSMTYQAASGAGAQNMRELIAQ 180

Query: 179 MGAAHASVADDLANPASAILDIDRKVAETLRSEAFPTEHF-GAPLGGSLIPWIDKELPNG 237
           MG  HASVAD LA+P+SAIL+IDRKVAET+RS+AFP ++F   PL GSLIPWID  + NG
Sbjct: 181 MGTIHASVADLLADPSSAILEIDRKVAETIRSDAFPKKNFRNTPLAGSLIPWIDVPVENG 240

Query: 238 QSREEWKAQAETNKILA----RFKNPIPVDGICVRVGAMRCHSQALTIKLNKDVPLTDIE 293
           QS+EEWK  AE NKIL     R +  IP+DG+CVR+GAMRCHSQALTIKL KDVPL +I 
Sbjct: 241 QSKEEWKGGAECNKILGKPAFRSQGSIPIDGLCVRIGAMRCHSQALTIKLKKDVPLDEIS 300

Query: 294 GLISQHNPWVKLVPNHREVSVRELTPAAVTGTLSVPVGRLRKLNMGSQYLGAFTVGDQLL 353
            ++++ N W K+VPN RE+S RELTPAAVTGTL+VPVGRL K+ MG +YL AFT GDQLL
Sbjct: 301 DMLAKANQWAKVVPNEREISERELTPAAVTGTLTVPVGRLHKMAMGPEYLAAFTCGDQLL 360

Query: 354 WGAAEPLRRMLRILLE 369
           WGAAEPLRRMLRILLE
Sbjct: 361 WGAAEPLRRMLRILLE 376


Lambda     K      H
   0.319    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 536
Number of extensions: 10
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 370
Length of database: 377
Length adjustment: 30
Effective length of query: 340
Effective length of database: 347
Effective search space:   117980
Effective search space used:   117980
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

Align candidate Dsui_3197 Dsui_3197 (aspartate-semialdehyde dehydrogenase, gamma-proteobacterial)
to HMM TIGR01745 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))

Software error:

../bin/blast/fastacmd -i /tmp/list.13497.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.13497.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.