Align succinyldiaminopimelate transaminase (EC 2.6.1.17) (characterized)
to candidate Dsui_2708 Dsui_2708 succinyldiaminopimelate transaminase
Query= BRENDA::Q9ZEX3 (397 letters) >lcl|FitnessBrowser__PS:Dsui_2708 Dsui_2708 succinyldiaminopimelate transaminase Length = 401 Score = 465 bits (1197), Expect = e-136 Identities = 240/397 (60%), Positives = 286/397 (72%), Gaps = 5/397 (1%) Query: 1 MNPRLDALHPYPFEKLRALLADAGKPTHDLPPINLSIGEPKHAAPACVGQAIAANLAGLS 60 MNP L L PYPFEKLR L P D I LSIGEP+HA P + +A+ ANL GL+ Sbjct: 1 MNPFLAKLQPYPFEKLRQLFQGV-TPNPDYQEIKLSIGEPQHATPGFIKEALTANLGGLA 59 Query: 61 VYPSTKGEPALRQAISQWLSRRYSIPAPDPESEVLPVLGSREALFAFAQTVIDPSAG--A 118 YP+++G PALRQAI+ W+ RRY + +P++E+LPV GSREALFAFAQTVIDPS G Sbjct: 60 NYPTSQGTPALRQAIAAWMERRYGLAGVNPDTEILPVNGSREALFAFAQTVIDPSRGYVP 119 Query: 119 LVVCPNPFYQIYEGAALLAGATPYYVNADPARDFGLRTGRVPDEVWRRTQLVFVCSPGNP 178 LVV PNPFYQIYEGAA LAGA PY++N P DF L + + W R QL++VCSPGNP Sbjct: 120 LVVSPNPFYQIYEGAAYLAGAEPYFLNTLPENDFSLELEALSEADWARVQLLYVCSPGNP 179 Query: 179 AGNVMSLEEWRTLFELSDRHGFVIAAYECYSEIYLDEDTPPLGSLQAARRLGRDRYTNLV 238 G V+ LE+W+ LF LSD++GFVIA+ ECYSEIY DE PPLG LQAA++LGR + LV Sbjct: 180 TGKVLDLEDWKKLFALSDKYGFVIASDECYSEIYFDEAKPPLGGLQAAKQLGRG-FERLV 238 Query: 239 AFSSLSKRSNVPGMRSGFVAGDAALLARFLLYRTYHGSAMSPVVSAASIAAWSMRRMCRK 298 FSSLSKRSNVPG+RSGFVAGDAA+L +FLLYRTYHG AM+P V AAS AW+ R+ Sbjct: 239 MFSSLSKRSNVPGLRSGFVAGDAAVLKKFLLYRTYHGGAMNPAVQAASAIAWNEEAHARE 298 Query: 299 T-AQYRAKFEAVLPILQNVLDVRAPQASFYLWAGTPGSDTAFARELYGRTGVTVLPGSLL 357 QY+ KF+AV PI+ +VL P ASFYLWA TP +DT FAR L V VLPGS L Sbjct: 299 NRRQYKEKFDAVTPIVASVLQTGLPDASFYLWARTPIADTEFARRLLADYNVVVLPGSYL 358 Query: 358 AREAHNANPGQGRIRIALVAPLDQCVQAAERIAHFAR 394 AREA NPG+ +RIALVAPL C++AAERI F + Sbjct: 359 AREARGVNPGENFVRIALVAPLADCLEAAERIRLFVQ 395 Lambda K H 0.321 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 578 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 401 Length adjustment: 31 Effective length of query: 366 Effective length of database: 370 Effective search space: 135420 Effective search space used: 135420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate Dsui_2708 Dsui_2708 (succinyldiaminopimelate transaminase)
to HMM TIGR03538 (dapC: succinyldiaminopimelate transaminase (EC 2.6.1.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03538.hmm # target sequence database: /tmp/gapView.28817.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03538 [M=395] Accession: TIGR03538 Description: DapC_gpp: succinyldiaminopimelate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-190 619.0 0.0 1.8e-190 618.8 0.0 1.0 1 lcl|FitnessBrowser__PS:Dsui_2708 Dsui_2708 succinyldiaminopimelat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_2708 Dsui_2708 succinyldiaminopimelate transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 618.8 0.0 1.8e-190 1.8e-190 1 395 [] 1 394 [. 1 394 [. 0.99 Alignments for each domain: == domain 1 score: 618.8 bits; conditional E-value: 1.8e-190 TIGR03538 1 mnpnlerlkpyPfeklaellkdvtppadleeialsiGePkhatPafvlealvenleelskyPttkGlpelreaiaeW 77 mnp l++l+pyPfekl++l+++vtp+ d++ei+lsiGeP+hatP f++eal++nl +l++yPt++G+p+lr+aia+W lcl|FitnessBrowser__PS:Dsui_2708 1 MNPFLAKLQPYPFEKLRQLFQGVTPNPDYQEIKLSIGEPQHATPGFIKEALTANLGGLANYPTSQGTPALRQAIAAW 77 9**************************************************************************** PP TIGR03538 78 lerrfelpagvdperqvlPvnGtrealfafvqavidrae..kalvvlPnPfyqiyeGaallagaepyflnctaengf 152 +err+ l+ v+p++++lPvnG+realfaf+q+vid+++ +lvv+PnPfyqiyeGaa+lagaepyfln+ +en+f lcl|FitnessBrowser__PS:Dsui_2708 78 MERRYGLAG-VNPDTEILPVNGSREALFAFAQTVIDPSRgyVPLVVSPNPFYQIYEGAAYLAGAEPYFLNTLPENDF 153 ******986.***************************99889*********************************** PP TIGR03538 153 kpdfdavpeevWkrvqllfvcsPgnPtGavlsleelkklleladkydfiiasdecyselyldeaeaPvGlleaaael 229 +++a++e W+rvqll+vcsPgnPtG+vl+le++kkl++l+dky+f+iasdecyse+y+dea++P+G l+aa++l lcl|FitnessBrowser__PS:Dsui_2708 154 SLELEALSEADWARVQLLYVCSPGNPTGKVLDLEDWKKLFALSDKYGFVIASDECYSEIYFDEAKPPLGGLQAAKQL 230 ***************************************************************************** PP TIGR03538 230 GrddfkrllvfhslskrsnvPGlrsGfvaGdaellkeflryrtyhGcampiavqlasiaaWedekhvrenralyrek 306 Gr f+rl++f+slskrsnvPGlrsGfvaGda++lk+fl yrtyhG am++avq+as aW++e+h renr++y+ek lcl|FitnessBrowser__PS:Dsui_2708 231 GR-GFERLVMFSSLSKRSNVPGLRSGFVAGDAAVLKKFLLYRTYHGGAMNPAVQAASAIAWNEEAHARENRRQYKEK 306 *8.9************************************************************************* PP TIGR03538 307 faavleilgavldlelPdasfylWlkvpdgddeafaralyeeenvkvlpGrylsreaegvnPGegrvrlalvaelee 383 f+av+ i+++vl+ lPdasfylW+++ ++ d++far+l ++ nv vlpG+yl+rea gvnPGe++vr+alva+l++ lcl|FitnessBrowser__PS:Dsui_2708 307 FDAVTPIVASVLQTGLPDASFYLWART-PIADTEFARRLLADYNVVVLPGSYLAREARGVNPGENFVRIALVAPLAD 382 ***************************.5************************************************ PP TIGR03538 384 cveaaerikkll 395 c eaaeri+ ++ lcl|FitnessBrowser__PS:Dsui_2708 383 CLEAAERIRLFV 394 ********9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (395 nodes) Target sequences: 1 (401 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.47 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory