Align N-acetyldiaminopimelate deacetylase; EC 3.5.1.47 (uncharacterized)
to candidate Dsui_0989 Dsui_0989 amidohydrolase
Query= curated2:Q836H7 (378 letters) >FitnessBrowser__PS:Dsui_0989 Length = 387 Score = 226 bits (575), Expect = 1e-63 Identities = 130/369 (35%), Positives = 201/369 (54%), Gaps = 16/369 (4%) Query: 8 ELIAIRRQLHQIPEIGLEEKETQAFLLNEIDKMKQPYLQVRTW--QTGILVFIEGKNPQK 65 EL A+RR +H PE+ +E T + E+++ ++V +TG++ + + ++ Sbjct: 11 ELTALRRDIHAHPELAFDESRTADIVARELERYG---IEVHRGIARTGVVGVLRNGSSKR 67 Query: 66 TIGWRADIDGLPIQEEVVSAFQSKRPGFMHACGHDFHMTIGLGVLKELSQQQP-DNNFLF 124 IG RAD+D LP++E+ +S+ G MHACGHD H + LG + L++Q+ D +F Sbjct: 68 AIGLRADMDALPLEEKNEFPHRSRHEGKMHACGHDGHTALLLGAARWLAEQRNFDGTVVF 127 Query: 125 LFQPAEENEAGGMLMYEDHAFGEWLPDEFYALHVNPDLPVGTISTRVGTLFAATCEVNIT 184 +FQPAEE+E G +M ED F ++ D Y LH P +P+G ++ G + A TC I Sbjct: 128 IFQPAEESEGGAAVMIEDGLFEKFPVDAVYGLHNWPGIPLGEMAIMPGPVMAGTCAFEIA 187 Query: 185 LKGKGGHAAFPHQANDMVLAATNLIQQAQTIVSRNVDPVVGAVVTFGTFHAGTACNVIAE 244 ++G G HAA PHQ D ++A + L+Q QT+VSR + P AVV+ FHAG+A N+I + Sbjct: 188 IRGHGCHAAMPHQGVDPIVAGSQLVQALQTVVSRTLHPCESAVVSVTQFHAGSAWNIIPD 247 Query: 245 EATLSGTIRTLTAETNEQTQRRIREISEGIAQSFQCEVTVHLDQKGYLPVVNE----PAC 300 +A L GTIRT E E +R I + G+A + ++ V D + Y P VN C Sbjct: 248 DAILRGTIRTFKPEVQETVERAIERLVSGVAAATGAQIGVTFDHR-YPPTVNSGPETEVC 306 Query: 301 TTNFIEYMSKQATVQFQQAPVAMTGEDFGYLLSKVPGTMFWLG---VASPYSLHSAKFEP 357 + + + A +M EDF Y+L + PG WLG +LH+ ++ Sbjct: 307 RHAARAVLGHERVI--TDALPSMGAEDFAYMLREKPGCYVWLGNGPGTGGCTLHNPHYDF 364 Query: 358 NEEALLFGV 366 N+EAL G+ Sbjct: 365 NDEALAVGI 373 Lambda K H 0.319 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 387 Length adjustment: 30 Effective length of query: 348 Effective length of database: 357 Effective search space: 124236 Effective search space used: 124236 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory