Align Homocitrate synthase; EC 2.3.3.14 (characterized)
to candidate Dsui_0578 Dsui_0578 homocitrate synthase NifV
Query= SwissProt::P05342 (385 letters) >FitnessBrowser__PS:Dsui_0578 Length = 384 Score = 436 bits (1120), Expect = e-127 Identities = 220/368 (59%), Positives = 280/368 (76%), Gaps = 1/368 (0%) Query: 1 MASVIIDDTTLRDGEQSAGVAFNADEKIAIARALAELGVPELEIGIPSMGEEEREVMHAI 60 M ++ I+DTTLRDGEQ+AGVAF A EK+AIA+ALA GVPE+E+GIP+MGE+E+EV+ AI Sbjct: 1 MTTITINDTTLRDGEQTAGVAFTAAEKLAIAQALAAAGVPEMEVGIPAMGEQEQEVIRAI 60 Query: 61 AGLGLSSRLLAWCRLCDVDLAAARSTGVTMVDLSLPVSDLMLHHKLNRDRDWALREVARL 120 AGLGLSSRL+ W R+C DL R +V+LS+PVSD + HKLN+D W L + R Sbjct: 61 AGLGLSSRLMVWGRMCAADLEVTRRCNAHIVNLSIPVSDQQIRHKLNKDHRWVLDSIRRF 120 Query: 121 VGEARMAGLEVCLGCEDASRADLEFVVQVGEVAQAAGARRLRFADTVGVMEPFGMLDRFR 180 V EAR AGLEVC+G ED+SRADL+F+ +V E AQAAGARR RFADT+GV++PF R Sbjct: 121 VPEARAAGLEVCVGGEDSSRADLDFLHRVMEAAQAAGARRFRFADTLGVLDPFITHQRIA 180 Query: 181 FLSRRLDMELEVHAHDDFGLATANTLAAVMGGATHINTTVNGLGERAGNAALEECVLALK 240 L R D+E+E+HAHDD GLATANTLAAV GATHINTTVNGLGERAGNA LEE V+AL+ Sbjct: 181 ALRARSDLEIEIHAHDDLGLATANTLAAVTAGATHINTTVNGLGERAGNAPLEESVIALR 240 Query: 241 NLHGIDTGIDTRGIPAISALVERASGRQVAWQKSVVGAGVFTHEAGIHVDGLLKHRRNYE 300 +L+ ID+G+D +PAIS LV +ASGR VA KS+VGA VFTHEAGIHVDGL K+ NY+ Sbjct: 241 HLYDIDSGVDPLQLPAISDLVAKASGRPVAVNKSIVGANVFTHEAGIHVDGLAKNPANYQ 300 Query: 301 GLNPDELGRSHSLVLGKHSGAHMVRNTYRDLGIELADWQSQALLGRIRAFSTRTKRRSPQ 360 +P E+G+ H +VLGKHSG+ V + Y+DLGI++ + ++ +L R+R+++ K R P Sbjct: 301 AFDPAEVGKGHRIVLGKHSGSTAVIHAYKDLGIDIDEGMARRILSRVRSYAMAFK-RPPG 359 Query: 361 PAELQDFY 368 EL +Y Sbjct: 360 FRELMSYY 367 Lambda K H 0.320 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 489 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 384 Length adjustment: 30 Effective length of query: 355 Effective length of database: 354 Effective search space: 125670 Effective search space used: 125670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate Dsui_0578 Dsui_0578 (homocitrate synthase NifV)
to HMM TIGR02660 (nifV: homocitrate synthase (EC 2.3.3.14))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR02660.hmm # target sequence database: /tmp/gapView.4641.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02660 [M=365] Accession: TIGR02660 Description: nifV_homocitr: homocitrate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-165 535.7 2.5 3.9e-165 535.5 2.5 1.0 1 lcl|FitnessBrowser__PS:Dsui_0578 Dsui_0578 homocitrate synthase N Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_0578 Dsui_0578 homocitrate synthase NifV # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 535.5 2.5 3.9e-165 3.9e-165 2 363 .. 4 365 .. 3 367 .. 0.99 Alignments for each domain: == domain 1 score: 535.5 bits; conditional E-value: 3.9e-165 TIGR02660 2 vlinDttLRDGEqaagvaFsaeEKlaiAkaLdeaGvdelEvGipamgeeEraairaiaalglkarllaWcRlraedi 78 ++inDttLRDGEq+agvaF+a+EKlaiA+aL++aGv+e+EvGipamge+E+++iraia lgl++rl++W R++a+d+ lcl|FitnessBrowser__PS:Dsui_0578 4 ITINDTTLRDGEQTAGVAFTAAEKLAIAQALAAAGVPEMEVGIPAMGEQEQEVIRAIAGLGLSSRLMVWGRMCAADL 80 89*************************************************************************** PP TIGR02660 79 eaaaevGvkavdlsvpvsdlqleaklkkdrawvleelkelvslakeeglkvsvgaeDasRadeeflvelaevakeag 155 e ++++ + v+ls+pvsd+q+++kl+kd++wvl++++++v a+ +gl+v+vg+eD+sRad +fl++++e a++ag lcl|FitnessBrowser__PS:Dsui_0578 81 EVTRRCNAHIVNLSIPVSDQQIRHKLNKDHRWVLDSIRRFVPEARAAGLEVCVGGEDSSRADLDFLHRVMEAAQAAG 157 ***************************************************************************** PP TIGR02660 156 akRlRfaDtvgvldPfstyelvkalraalelelElHaHnDlGlAtAntlaavkaGassvsvtvlGlGERAGnAalee 232 a+R+RfaDt+gvldPf t+++++alra+++le+E+HaH+DlGlAtAntlaav+aGa+++++tv+GlGERAGnA+lee lcl|FitnessBrowser__PS:Dsui_0578 158 ARRFRFADTLGVLDPFITHQRIAALRARSDLEIEIHAHDDLGLATANTLAAVTAGATHINTTVNGLGERAGNAPLEE 234 ***************************************************************************** PP TIGR02660 233 valalkellgldtgidlselkelsqlvakasgraleaqkavvGesvFaHEsGiHvdgllkdeatYesldPeevGrer 309 ++al++l+++d g+d +l+++s+lvakasgr+++++k++vG++vF+HE+GiHvdgl k++a+Y+++dP+evG+ + lcl|FitnessBrowser__PS:Dsui_0578 235 SVIALRHLYDIDSGVDPLQLPAISDLVAKASGRPVAVNKSIVGANVFTHEAGIHVDGLAKNPANYQAFDPAEVGKGH 311 ***************************************************************************** PP TIGR02660 310 elviGKHsgraaviealkelgleleeeeaeelleavravaerlKrsleeeelaa 363 ++v+GKHsg++avi+a+k+lg++++e a+++l++vr++a ++Kr++ +el++ lcl|FitnessBrowser__PS:Dsui_0578 312 RIVLGKHSGSTAVIHAYKDLGIDIDEGMARRILSRVRSYAMAFKRPPGFRELMS 365 ************************************************999987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (384 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.57 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory