Align cystathionine gamma-synthase (EC 2.5.1.48) (characterized)
to candidate Dsui_0429 Dsui_0429 cystathionine beta-lyase/cystathionine gamma-synthase
Query= BRENDA::A0PKT3 (388 letters) >FitnessBrowser__PS:Dsui_0429 Length = 382 Score = 275 bits (703), Expect = 2e-78 Identities = 160/355 (45%), Positives = 216/355 (60%), Gaps = 10/355 (2%) Query: 35 PIYASSTFAQDGVGGLRGGYEYARTGNPTRTALEAALAAVEDAAFGRAFSSGMAAADCAL 94 P++ ++TF + G G GG Y+R G+P EA L +E A F+SGMAAA L Sbjct: 33 PLHLATTFERAGDGSYPGGRVYSRDGSPAYDGPEALLKELEGGAAAALFASGMAAASAVL 92 Query: 95 RAMLRPGDHVVIPDDAYGGTFRLIDKVFTGWNVEYTPVALADLDAVRAAIRPTTRLIWVE 154 +A L+PG VV P Y + + W + T AD + A ++ L+W+E Sbjct: 93 QA-LKPGARVVAPRAMYWALRNWMIQFAANWQL--TLEFFADDAELAALLQRPADLVWLE 149 Query: 155 TPTNPLLSIADIAGIAQLGADSSAKVLVDNTFASPALQQPLSLGADVVLHSTTKYIGGHS 214 TP NP I DIA A+ + A+++VD+T +P +PL LGADVV+HS TKY+ GHS Sbjct: 150 TPANPTWEITDIAAAAKAAHAAGARLVVDSTVPTPVFTRPLELGADVVMHSATKYLNGHS 209 Query: 215 DVVGGALVT-NDEELDQSFAFLQNGAGAVPGPFDAYLTMRGLKTLVLRMQRHSENAAAVA 273 DVV GALVT +++ Q ++ GAV GPF+A+L RG++TL R++ + +AAA+A Sbjct: 210 DVVAGALVTRTEDDFWQRIKTVRALGGAVLGPFEAWLLARGMRTLFPRVRTAAASAAAIA 269 Query: 274 EFLAEHPAISTVLYPGLPSHPGHAVAARQMR-GFGGMVSVRMRAGRTAAEQLCAKTNIFI 332 H + VLYPGLPSHPGHAVAARQM+ GFG M+S+R+ G AA+ + A+ +F Sbjct: 270 SHFHGHAKVGLVLYPGLPSHPGHAVAARQMQGGFGAMLSLRIAGGEAAAKAVAARLQVFQ 329 Query: 333 LAESLGSVESLIEHPSAMTHASTAGSQLEVPDDLVRLSVGIEDVADLLDDLKQAL 387 A SLGSVESL+EH AS G PDDL+RLSVGIE ADL+ DL+QAL Sbjct: 330 RATSLGSVESLVEH-----RASVEGPGTFCPDDLLRLSVGIEATADLIADLEQAL 379 Lambda K H 0.318 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 463 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 382 Length adjustment: 30 Effective length of query: 358 Effective length of database: 352 Effective search space: 126016 Effective search space used: 126016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory